Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	171023
Gene name	ASXL transcriptional regulator 1
Gene symbol	ASXL1
Synonyms (NCBI Gene)	BOPSMDS
Chromosome	20
Chromosome location	20q11.21
Summary	This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which ar

Show/Hide all (52)

SNP ID	Visualize variation	Clinical significance	Consequence
rs111316898	C>T	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs200702600	C>A,T	Not-provided, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, stop gained
rs371369583	C>A,G	Pathogenic	Genic downstream transcript variant, coding sequence variant, stop gained
rs373145711	C>T	Pathogenic	Genic downstream transcript variant, coding sequence variant, stop gained
rs373221034	C>T	Pathogenic	Genic downstream transcript variant, coding sequence variant, stop gained
rs387907077	C>T	Pathogenic	Genic downstream transcript variant, coding sequence variant, stop gained
rs387907078	C>T	Pathogenic	Genic downstream transcript variant, coding sequence variant, stop gained
rs397515401	C>T	Pathogenic	Genic downstream transcript variant, coding sequence variant, stop gained
rs542568224	C>T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs750170870	->C	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs750318549	GG>-,G,GGG	Pathogenic, likely-pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs754129466	C>G,T	Likely-benign, pathogenic	Coding sequence variant, missense variant, stop gained, genic downstream transcript variant
rs764651405	C>G,T	Pathogenic	Coding sequence variant, missense variant, stop gained, genic downstream transcript variant
rs766433101	AGAGAGGCGGCCACCACTGCCAT>-	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs777537805	TG>-	Likely-pathogenic, uncertain-significance, pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant
rs786205552	G>A,C	Likely-pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs886039670	TG>-	Pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant
rs886039722	C>A	Pathogenic	Genic downstream transcript variant, stop gained, coding sequence variant
rs886041975	C>T	Pathogenic	Genic downstream transcript variant, stop gained, coding sequence variant
rs886043994	GT>-	Likely-pathogenic, pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant
rs1057518458	->AGGC	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1064793988	C>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1064796100	G>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1064796772	CT>-	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1261178797	T>A,C	Pathogenic	Genic downstream transcript variant, synonymous variant, stop gained, coding sequence variant
rs1427299519	C>T	Pathogenic	Stop gained, genic downstream transcript variant, coding sequence variant
rs1486082302	C>T	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1555900832	->A	Likely-pathogenic	Genic upstream transcript variant, coding sequence variant, frameshift variant
rs1555901138	A>T	Pathogenic	Genic upstream transcript variant, coding sequence variant, stop gained
rs1555911496	->C	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555911508	G>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555911515	->A	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555912285	TGTTGAGC>CAA	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555912296	G>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555912392	->CAGTGAG	Likely-pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant, inframe indel
rs1555912419	G>A	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1555912648	CTCC>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555912709	GACAG>-	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1555912897	->G	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555912930	G>T	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1555912974	C>T	Likely-pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1569324457	AG>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1569333361	G>A	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1569337176	C>-	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1569337452	C>T	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1569339085	G>T	Pathogenic	Stop gained, coding sequence variant, genic downstream transcript variant
rs1600583334	->CT	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1600586587	->G	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1600588199	CAAGG>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1600588239	->AC	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1600592990	G>-	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1600594932	->T	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043339	hsa-miR-331-3p	CLASH	23622248
MIRT042036	hsa-miR-484	CLASH	23622248
MIRT041588	hsa-miR-193b-3p	CLASH	23622248
MIRT041588	hsa-miR-193b-3p	CLASH	23622248
MIRT481416	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT481415	hsa-miR-4463	PAR-CLIP	23592263
MIRT481414	hsa-miR-1321	PAR-CLIP	23592263
MIRT481413	hsa-miR-4739	PAR-CLIP	23592263
MIRT481412	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT481411	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT481410	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT481408	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT481409	hsa-miR-4270	PAR-CLIP	23592263
MIRT481407	hsa-miR-4441	PAR-CLIP	23592263
MIRT481406	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT235611	hsa-miR-6077	PAR-CLIP	23592263
MIRT481405	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT481404	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT481403	hsa-miR-4736	PAR-CLIP	23592263
MIRT481402	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT481401	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT481400	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT481399	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT481397	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT481398	hsa-miR-3190-3p	PAR-CLIP	23592263
MIRT481396	hsa-miR-7150	PAR-CLIP	23592263
MIRT728290	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT728289	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT728288	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT728287	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT732727	hsa-miR-206	Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	34234552
MIRT481416	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT481415	hsa-miR-4463	PAR-CLIP	23592263
MIRT481414	hsa-miR-1321	PAR-CLIP	23592263
MIRT481413	hsa-miR-4739	PAR-CLIP	23592263
MIRT481412	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT481411	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT481410	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT481408	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT481409	hsa-miR-4270	PAR-CLIP	23592263
MIRT481407	hsa-miR-4441	PAR-CLIP	23592263
MIRT481406	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT235611	hsa-miR-6077	PAR-CLIP	23592263
MIRT481405	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT481404	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT481403	hsa-miR-4736	PAR-CLIP	23592263
MIRT481402	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT481401	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT481400	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT481399	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT481397	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT481398	hsa-miR-3190-3p	PAR-CLIP	23592263
MIRT481396	hsa-miR-7150	PAR-CLIP	23592263
MIRT803485	hsa-miR-1182	CLIP-seq
MIRT803486	hsa-miR-1245b-3p	CLIP-seq
MIRT803487	hsa-miR-1265	CLIP-seq
MIRT803488	hsa-miR-1287	CLIP-seq
MIRT803489	hsa-miR-141	CLIP-seq
MIRT803490	hsa-miR-154	CLIP-seq
MIRT803491	hsa-miR-183	CLIP-seq
MIRT803492	hsa-miR-185	CLIP-seq
MIRT803493	hsa-miR-200a	CLIP-seq
MIRT803494	hsa-miR-203	CLIP-seq
MIRT803495	hsa-miR-23a	CLIP-seq
MIRT803496	hsa-miR-23b	CLIP-seq
MIRT803497	hsa-miR-23c	CLIP-seq
MIRT803498	hsa-miR-2467-3p	CLIP-seq
MIRT803499	hsa-miR-3064-3p	CLIP-seq
MIRT803500	hsa-miR-3125	CLIP-seq
MIRT803501	hsa-miR-3135b	CLIP-seq
MIRT803502	hsa-miR-3147	CLIP-seq
MIRT803503	hsa-miR-3150b-3p	CLIP-seq
MIRT803504	hsa-miR-3165	CLIP-seq
MIRT803505	hsa-miR-3190	CLIP-seq
MIRT803506	hsa-miR-323-5p	CLIP-seq
MIRT803507	hsa-miR-3605-5p	CLIP-seq
MIRT803508	hsa-miR-3609	CLIP-seq
MIRT803509	hsa-miR-3622a-3p	CLIP-seq
MIRT803510	hsa-miR-3622b-3p	CLIP-seq
MIRT803511	hsa-miR-3662	CLIP-seq
MIRT803512	hsa-miR-3681	CLIP-seq
MIRT803513	hsa-miR-3689a-3p	CLIP-seq
MIRT803514	hsa-miR-3689c	CLIP-seq
MIRT803515	hsa-miR-3916	CLIP-seq
MIRT803516	hsa-miR-3942-3p	CLIP-seq
MIRT803517	hsa-miR-3977	CLIP-seq
MIRT803518	hsa-miR-4261	CLIP-seq
MIRT803519	hsa-miR-4266	CLIP-seq
MIRT803520	hsa-miR-4287	CLIP-seq
MIRT803521	hsa-miR-4306	CLIP-seq
MIRT803522	hsa-miR-4425	CLIP-seq
MIRT803523	hsa-miR-4426	CLIP-seq
MIRT803524	hsa-miR-4456	CLIP-seq
MIRT803525	hsa-miR-4495	CLIP-seq
MIRT803526	hsa-miR-451b	CLIP-seq
MIRT803527	hsa-miR-4644	CLIP-seq
MIRT803528	hsa-miR-4647	CLIP-seq
MIRT803529	hsa-miR-4662b	CLIP-seq
MIRT803530	hsa-miR-4672	CLIP-seq
MIRT803531	hsa-miR-4685-3p	CLIP-seq
MIRT803532	hsa-miR-4695-5p	CLIP-seq
MIRT803533	hsa-miR-4764-3p	CLIP-seq
MIRT803534	hsa-miR-4779	CLIP-seq
MIRT803535	hsa-miR-4780	CLIP-seq
MIRT803536	hsa-miR-4781-3p	CLIP-seq
MIRT803537	hsa-miR-4784	CLIP-seq
MIRT803538	hsa-miR-494	CLIP-seq
MIRT803539	hsa-miR-520g	CLIP-seq
MIRT803540	hsa-miR-520h	CLIP-seq
MIRT803541	hsa-miR-542-3p	CLIP-seq
MIRT803542	hsa-miR-548ah	CLIP-seq
MIRT803543	hsa-miR-576-3p	CLIP-seq
MIRT803544	hsa-miR-603	CLIP-seq
MIRT803545	hsa-miR-623	CLIP-seq
MIRT803546	hsa-miR-668	CLIP-seq
MIRT803547	hsa-miR-765	CLIP-seq
MIRT803548	hsa-miR-875-3p	CLIP-seq
MIRT803549	hsa-miR-876-3p	CLIP-seq
MIRT803550	hsa-miR-885-3p	CLIP-seq
MIRT1937248	hsa-miR-1206	CLIP-seq
MIRT1937249	hsa-miR-1278	CLIP-seq
MIRT803491	hsa-miR-183	CLIP-seq
MIRT803492	hsa-miR-185	CLIP-seq
MIRT1937250	hsa-miR-2278	CLIP-seq
MIRT1937251	hsa-miR-300	CLIP-seq
MIRT1937252	hsa-miR-3154	CLIP-seq
MIRT1937253	hsa-miR-3156-5p	CLIP-seq
MIRT1937254	hsa-miR-3157-5p	CLIP-seq
MIRT1937255	hsa-miR-3158-3p	CLIP-seq
MIRT1937256	hsa-miR-3177-5p	CLIP-seq
MIRT1937257	hsa-miR-3187-3p	CLIP-seq
MIRT1937258	hsa-miR-329	CLIP-seq
MIRT1937259	hsa-miR-362-3p	CLIP-seq
MIRT1937260	hsa-miR-3646	CLIP-seq
MIRT1937261	hsa-miR-381	CLIP-seq
MIRT1937262	hsa-miR-3941	CLIP-seq
MIRT1937263	hsa-miR-4274	CLIP-seq
MIRT803521	hsa-miR-4306	CLIP-seq
MIRT1937264	hsa-miR-4318	CLIP-seq
MIRT1937265	hsa-miR-4480	CLIP-seq
MIRT803525	hsa-miR-4495	CLIP-seq
MIRT1937266	hsa-miR-4519	CLIP-seq
MIRT1937267	hsa-miR-4524	CLIP-seq
MIRT1937268	hsa-miR-4528	CLIP-seq
MIRT1937269	hsa-miR-4529-5p	CLIP-seq
MIRT803527	hsa-miR-4644	CLIP-seq
MIRT1937270	hsa-miR-4666-3p	CLIP-seq
MIRT1937271	hsa-miR-4676-5p	CLIP-seq
MIRT1937272	hsa-miR-4691-3p	CLIP-seq
MIRT1937273	hsa-miR-4693-5p	CLIP-seq
MIRT1937274	hsa-miR-4698	CLIP-seq
MIRT1937275	hsa-miR-4705	CLIP-seq
MIRT1937276	hsa-miR-4712-5p	CLIP-seq
MIRT1937277	hsa-miR-4721	CLIP-seq
MIRT1937278	hsa-miR-4725-5p	CLIP-seq
MIRT1937279	hsa-miR-4786-3p	CLIP-seq
MIRT1937280	hsa-miR-4789-5p	CLIP-seq
MIRT1937281	hsa-miR-504	CLIP-seq
MIRT1937282	hsa-miR-513a-3p	CLIP-seq
MIRT803541	hsa-miR-542-3p	CLIP-seq
MIRT1937283	hsa-miR-552	CLIP-seq
MIRT1937284	hsa-miR-575	CLIP-seq
MIRT1937285	hsa-miR-600	CLIP-seq
MIRT803544	hsa-miR-603	CLIP-seq
MIRT1937286	hsa-miR-770-5p	CLIP-seq
MIRT1937287	hsa-miR-877	CLIP-seq
MIRT803550	hsa-miR-885-3p	CLIP-seq
MIRT1937288	hsa-miR-892a	CLIP-seq
MIRT2176912	hsa-miR-1248	CLIP-seq
MIRT2176913	hsa-miR-1256	CLIP-seq
MIRT1937249	hsa-miR-1278	CLIP-seq
MIRT2176914	hsa-miR-1297	CLIP-seq
MIRT2176915	hsa-miR-1343	CLIP-seq
MIRT2176916	hsa-miR-135a	CLIP-seq
MIRT2176917	hsa-miR-135b	CLIP-seq
MIRT803489	hsa-miR-141	CLIP-seq
MIRT2176918	hsa-miR-1827	CLIP-seq
MIRT803491	hsa-miR-183	CLIP-seq
MIRT803492	hsa-miR-185	CLIP-seq
MIRT2176919	hsa-miR-1915	CLIP-seq
MIRT803493	hsa-miR-200a	CLIP-seq
MIRT803494	hsa-miR-203	CLIP-seq
MIRT2176920	hsa-miR-2114	CLIP-seq
MIRT803495	hsa-miR-23a	CLIP-seq
MIRT803496	hsa-miR-23b	CLIP-seq
MIRT803497	hsa-miR-23c	CLIP-seq
MIRT2176921	hsa-miR-26a	CLIP-seq
MIRT2176922	hsa-miR-26b	CLIP-seq
MIRT2176923	hsa-miR-2964a-5p	CLIP-seq
MIRT1937251	hsa-miR-300	CLIP-seq
MIRT803499	hsa-miR-3064-3p	CLIP-seq
MIRT2176924	hsa-miR-3064-5p	CLIP-seq
MIRT2176925	hsa-miR-3119	CLIP-seq
MIRT803503	hsa-miR-3150b-3p	CLIP-seq
MIRT2176926	hsa-miR-3155	CLIP-seq
MIRT2176927	hsa-miR-3155b	CLIP-seq
MIRT1937253	hsa-miR-3156-5p	CLIP-seq
MIRT1937254	hsa-miR-3157-5p	CLIP-seq
MIRT1937255	hsa-miR-3158-3p	CLIP-seq
MIRT803504	hsa-miR-3165	CLIP-seq
MIRT2176928	hsa-miR-3176	CLIP-seq
MIRT1937256	hsa-miR-3177-5p	CLIP-seq
MIRT1937257	hsa-miR-3187-3p	CLIP-seq
MIRT803506	hsa-miR-323-5p	CLIP-seq
MIRT2176929	hsa-miR-326	CLIP-seq
MIRT1937258	hsa-miR-329	CLIP-seq
MIRT2176930	hsa-miR-330-5p	CLIP-seq
MIRT2176931	hsa-miR-3619-3p	CLIP-seq
MIRT2176932	hsa-miR-3622b-5p	CLIP-seq
MIRT1937259	hsa-miR-362-3p	CLIP-seq
MIRT2176933	hsa-miR-3652	CLIP-seq
MIRT2176934	hsa-miR-3667-3p	CLIP-seq
MIRT2176935	hsa-miR-3670	CLIP-seq
MIRT1937261	hsa-miR-381	CLIP-seq
MIRT2176936	hsa-miR-3922-3p	CLIP-seq
MIRT1937262	hsa-miR-3941	CLIP-seq
MIRT803517	hsa-miR-3977	CLIP-seq
MIRT803519	hsa-miR-4266	CLIP-seq
MIRT1937263	hsa-miR-4274	CLIP-seq
MIRT803520	hsa-miR-4287	CLIP-seq
MIRT2176937	hsa-miR-4302	CLIP-seq
MIRT803521	hsa-miR-4306	CLIP-seq
MIRT1937264	hsa-miR-4318	CLIP-seq
MIRT2176938	hsa-miR-4328	CLIP-seq
MIRT2176939	hsa-miR-4430	CLIP-seq
MIRT2176940	hsa-miR-4434	CLIP-seq
MIRT803524	hsa-miR-4456	CLIP-seq
MIRT2176941	hsa-miR-4457	CLIP-seq
MIRT2176942	hsa-miR-4465	CLIP-seq
MIRT2176943	hsa-miR-4471	CLIP-seq
MIRT2176944	hsa-miR-4488	CLIP-seq
MIRT2176945	hsa-miR-4505	CLIP-seq
MIRT2176946	hsa-miR-4516	CLIP-seq
MIRT1937266	hsa-miR-4519	CLIP-seq
MIRT803526	hsa-miR-451b	CLIP-seq
MIRT1937267	hsa-miR-4524	CLIP-seq
MIRT1937268	hsa-miR-4528	CLIP-seq
MIRT1937269	hsa-miR-4529-5p	CLIP-seq
MIRT2176947	hsa-miR-4531	CLIP-seq
MIRT803527	hsa-miR-4644	CLIP-seq
MIRT2176948	hsa-miR-4659a-3p	CLIP-seq
MIRT2176949	hsa-miR-4659b-3p	CLIP-seq
MIRT1937270	hsa-miR-4666-3p	CLIP-seq
MIRT1937271	hsa-miR-4676-5p	CLIP-seq
MIRT803531	hsa-miR-4685-3p	CLIP-seq
MIRT2176950	hsa-miR-4690-5p	CLIP-seq
MIRT1937272	hsa-miR-4691-3p	CLIP-seq
MIRT1937273	hsa-miR-4693-5p	CLIP-seq
MIRT803532	hsa-miR-4695-5p	CLIP-seq
MIRT2176951	hsa-miR-4697-5p	CLIP-seq
MIRT1937274	hsa-miR-4698	CLIP-seq
MIRT1937275	hsa-miR-4705	CLIP-seq
MIRT1937276	hsa-miR-4712-5p	CLIP-seq
MIRT1937277	hsa-miR-4721	CLIP-seq
MIRT2176952	hsa-miR-4722-5p	CLIP-seq
MIRT2176953	hsa-miR-4761-3p	CLIP-seq
MIRT2176954	hsa-miR-4768-3p	CLIP-seq
MIRT2176955	hsa-miR-4776-5p	CLIP-seq
MIRT803534	hsa-miR-4779	CLIP-seq
MIRT803535	hsa-miR-4780	CLIP-seq
MIRT803537	hsa-miR-4784	CLIP-seq
MIRT2176956	hsa-miR-490-3p	CLIP-seq
MIRT2176957	hsa-miR-490-5p	CLIP-seq
MIRT2176958	hsa-miR-498	CLIP-seq
MIRT1937282	hsa-miR-513a-3p	CLIP-seq
MIRT2176959	hsa-miR-513b	CLIP-seq
MIRT803541	hsa-miR-542-3p	CLIP-seq
MIRT1937283	hsa-miR-552	CLIP-seq
MIRT1937284	hsa-miR-575	CLIP-seq
MIRT803543	hsa-miR-576-3p	CLIP-seq
MIRT803544	hsa-miR-603	CLIP-seq
MIRT803545	hsa-miR-623	CLIP-seq
MIRT2176960	hsa-miR-637	CLIP-seq
MIRT2176961	hsa-miR-665	CLIP-seq
MIRT2176962	hsa-miR-760	CLIP-seq
MIRT803547	hsa-miR-765	CLIP-seq
MIRT1937286	hsa-miR-770-5p	CLIP-seq
MIRT803549	hsa-miR-876-3p	CLIP-seq
MIRT803550	hsa-miR-885-3p	CLIP-seq
MIRT1937288	hsa-miR-892a	CLIP-seq
MIRT2176963	hsa-miR-940	CLIP-seq
MIRT803491	hsa-miR-183	CLIP-seq
MIRT1937255	hsa-miR-3158-3p	CLIP-seq
MIRT803506	hsa-miR-323-5p	CLIP-seq
MIRT1937263	hsa-miR-4274	CLIP-seq
MIRT2176941	hsa-miR-4457	CLIP-seq
MIRT1937266	hsa-miR-4519	CLIP-seq
MIRT1937267	hsa-miR-4524	CLIP-seq
MIRT1937277	hsa-miR-4721	CLIP-seq
MIRT1937282	hsa-miR-513a-3p	CLIP-seq
MIRT2176959	hsa-miR-513b	CLIP-seq
MIRT2176962	hsa-miR-760	CLIP-seq
MIRT803548	hsa-miR-875-3p	CLIP-seq
MIRT803549	hsa-miR-876-3p	CLIP-seq
MIRT803550	hsa-miR-885-3p	CLIP-seq
MIRT1937279	hsa-miR-4786-3p	CLIP-seq
MIRT1937280	hsa-miR-4789-5p	CLIP-seq
MIRT2176913	hsa-miR-1256	CLIP-seq
MIRT1937252	hsa-miR-3154	CLIP-seq
MIRT2464884	hsa-miR-338-3p	CLIP-seq
MIRT803526	hsa-miR-451b	CLIP-seq
MIRT2464885	hsa-miR-4530	CLIP-seq
MIRT2464886	hsa-miR-4696	CLIP-seq
MIRT2464887	hsa-miR-766	CLIP-seq
MIRT803517	hsa-miR-3977	CLIP-seq
MIRT2480293	hsa-miR-4291	CLIP-seq
MIRT2480294	hsa-miR-545	CLIP-seq
MIRT803517	hsa-miR-3977	CLIP-seq
MIRT2480293	hsa-miR-4291	CLIP-seq
MIRT2480294	hsa-miR-545	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SOX2	Activation	22542624

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IEA
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0005515	Function	Protein binding	IPI	16606617, 18624398, 19615732, 20436459, 22897849, 27705803, 32296183, 33961781, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009887	Process	Animal organ morphogenesis	IBA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032526	Process	Response to retinoic acid	ISS
GO:0035359	Process	Negative regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035359	Process	Negative regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0035517	Component	PR-DUB complex	IBA
GO:0035517	Component	PR-DUB complex	IDA	20436459
GO:0035517	Component	PR-DUB complex	IPI	20436459
GO:0035564	Process	Regulation of kidney size	IEA
GO:0042974	Function	Nuclear retinoic acid receptor binding	IEA
GO:0042974	Function	Nuclear retinoic acid receptor binding	ISS
GO:0042975	Function	Peroxisome proliferator activated receptor binding	IBA
GO:0042975	Function	Peroxisome proliferator activated receptor binding	IEA
GO:0042975	Function	Peroxisome proliferator activated receptor binding	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048386	Process	Positive regulation of retinoic acid receptor signaling pathway	IEA
GO:0048386	Process	Positive regulation of retinoic acid receptor signaling pathway	ISS
GO:0048534	Process	Hematopoietic or lymphoid organ development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048539	Process	Bone marrow development	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0060348	Process	Bone development	IEA
GO:0060430	Process	Lung saccule development	IEA
GO:0072015	Process	Podocyte development	IEA

MIM	HGNC	e!Ensembl
612990	18318	ENSG00000171456

Q8IXJ9

Protein name

Polycomb group protein ASXL1 (Additional sex combs-like protein 1)

Protein function

Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG) (PubMed:16606617

PDB

8H1T , 8SVF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05066	HARE-HTH	11 → 83	HB1, ASXL, restriction endonuclease HTH domain	Family
PF13919	ASXH	236 → 361	Asx homology domain	Domain
PF13922	PHD_3	1479 → 1539	PHD domain of transcriptional enhancer, Asx	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low level. Expressed in heart, brain, skeletal muscle, placenta, pancreas, spleen, prostate, small intestine, colon, peripheral blood, leukocytes, bone marrow and fetal liver. Highly expressed in testes. {ECO:000026

Sequence

MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAML
HSNSRGGEGLFYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTADVESCGSNEASTVS
GENDVSLDETSSNASCSTESQSRPLSNPRDSYRASSQANKQKKKTGVMLPRVVLTPLKVN
GAHVESASGFSGCHADGESGSPSSSSSGSLALGSAAIRGQAEVTQDPAPLLRGFRKPATG
QMKRNRGEEIDFETPGSILVNTNLRALINSRTFHALPSHFQQQLLFLLPEVDRQVGTDGL
LRLSSSALNNEFFTHAAQSWRERLADGEFTHEMQVRIRQEMEKEKKVEQWKEKFFEDYYG
QKLGLTKEESLQQNVGQEEAEIKSGLCVPGESVRIQRGPATRQRDGHFKKRSRPDLRTRA
RRNLYKKQESEQAGVAKDAKSVASDVPLYKDGEAKTDPAGLSSPHLPGTSSAAPDLEGPE
FPVESVASRIQAEPDNLARASASPDRIPSLPQETVDQEPKDQKRKSFEQAASASFPEKKP
RLEDRQSFRNTIESVHTEKPQPTKEEPKVPPIRIQLSRIKPPWVVKGQPTYQICPRIIPT
TESSCRGWTGARTLADIKARALQVRGARGHHCHREAATTAIGGGGGPGGGGGGATDEGGG
RGSSSGDGGEACGHPEPRGGPSTPGKCTSDLQRTQLLPPYPLNGEHTQAGTAMSRARRED
LPSLRKEESCLLQRATVGLTDGLGDASQLPVAPTGDQPCQALPLLSSQTSVAERLVEQPQ
LHPDVRTECESGTTSWESDDEEQGPTVPADNGPIPSLVGDDTLEKGTGQALDSHPTMKDP
VNVTPSSTPESSPTDCLQNRAFDDELGLGGSCPPMRESDTRQENLKTKALVSNSSLHWIP
IPSNDEVVKQPKPESREHIPSVEPQVGEEWEKAAPTPPALPGDLTAEEGLDPLDSLTSLW
TVPSRGGSDSNGSYCQQVDIEKLKINGDSEALSPHGESTDTASDFEGHLTEDSSEADTRE
AAVTKGSSVDKDEKPNWNQSAPLSKVNGDMRLVTRTDGMVAPQSWVSRVCAVRQKIPDSL
LLASTEYQPRAVCLSMPGSSVEATNPLVMQLLQGSLPLEKVLPPAHDDSMSESPQVPLTK
DQSHGSLRMGSLHGLGKNSGMVDGSSPSSLRALKEPLLPDSCETGTGLARIEATQAPGAP
QKNCKAVPSFDSLHPVTNPITSSRKLEEMDSKEQFSSFSCEDQKEVRAMSQDSNSNAAPG
KSPGDLTTSRTPRFSSPNVISFGPEQTGRALGDQSNVTGQGKKLFGSGNVAATLQRPRPA
DPMPLPAEIPPVFPSGKLGPSTNSMSGGVQTPREDWAPKPHAFVGSVKNEKTFVGGPLKA
NAENRKATGHSPLELVGHLEGMPFVMDLPFWKLPREPGKGLSEPLEPSSLPSQLSIKQAF
YGKLSKLQLSSTSFNYSSSSPTFPKGLAGSVVQLSHKANFGASHSASLSLQMFTDSSTVE
SISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR

Sequence length

1541

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex		UCH proteinases

351

Show/Hide Causal Diseases (19)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal brain morphology	Likely pathogenic; Pathogenic	rs750318549	RCV001526628
ASXL1-related disorder	Pathogenic; Likely pathogenic	rs752263134, rs1167715259, rs750318549, rs1555912648	RCV003335919 RCV004550677 RCV004740262 RCV004722989
Atypical chronic myeloid leukemia, BCR-ABL1 negative	Pathogenic	rs2515552708	RCV003232901
Autism spectrum disorder	Likely pathogenic	rs2011568558	RCV001291374
Bohring-Opitz syndrome	Likely pathogenic; Pathogenic	rs2048205050, rs757040754, rs2123267182, rs1311986203, rs2145372935, rs2145360404, rs2011567269, rs748946310, rs765327792, rs2011649912, rs2515583794, rs2011609101, rs2515587165, rs2515535483, rs2515591610 View all (42 more)	RCV001333854 RCV001333853 RCV001449799 RCV001528120 RCV001548759 RCV005256821 RCV001814854 RCV001844687 RCV002271756 RCV002275470 RCV002284024 RCV002308473 RCV002468718 RCV003223504 RCV003224938 RCV003224944 RCV005418039 RCV002250612 RCV002470834 RCV000856733 RCV003444543 RCV003883375 RCV003985230 RCV003985236 RCV003991306 RCV003995160 RCV004018027 RCV004699149 RCV004594891 RCV004595142 RCV000023976 RCV000023977 RCV000023978 RCV000023979 RCV000023980 RCV000677687 RCV000655943 RCV000032664 RCV000032665 RCV000578410 RCV000578382 RCV002499012 RCV000679929 RCV000735213 RCV002282359 RCV005256676 RCV000779755 RCV000779754 RCV000824828 RCV000856763 RCV000990296 RCV000995699 RCV001706715 RCV001090157 RCV001253324 RCV001293689 RCV001293687
Cafe-au-lait spot	Likely pathogenic; Pathogenic	rs766433101	RCV001003812
Developmental delay	Pathogenic	rs373145711	RCV000415151
Diffuse midline glioma, H3 K27M-mutant	Likely pathogenic; Pathogenic	rs750318549	RCV006254070
dystrophia	Pathogenic	rs373145711	RCV000415151
Ependymoma	Likely pathogenic; Pathogenic	rs750318549	RCV006254069
Juvenile myelomonocytic leukemia	Likely pathogenic; Pathogenic	rs766433101	RCV001003812
Microcephaly	Pathogenic	rs1221031683	RCV001252687
Myelodysplasia	Pathogenic	rs1261178797	RCV000660864
Myelodysplastic syndrome	Likely pathogenic; Pathogenic	rs2515557358, rs2515584691, rs373145711, rs1555912897, rs373221034, rs1600586587	RCV002283630 RCV003883375 RCV001199371 RCV002499012 RCV003147544 RCV004768766
Neoplasm	Pathogenic; Likely pathogenic	rs777537805, rs750318549	RCV006273696 RCV005230955
Neurodevelopmental abnormality	Pathogenic	rs2011867276	RCV001264722
Primary brain neoplasm	Pathogenic	rs1366953593	RCV006254407
Rubinstein Taybi like syndrome	Pathogenic; Likely pathogenic	rs754129466, rs2011901554	RCV001261776 RCV001261775
Thyroid cancer, nonmedullary, 1	Pathogenic	rs376029425	RCV005912655

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	-	rs1254271466	RCV005922517
Colon adenocarcinoma	-; Likely benign	rs2123271967, rs143952412	RCV005932003 RCV005902963
Delayed speech and language development	Uncertain significance	rs780662350	RCV000498145
Floppy infant	Uncertain significance	rs780662350	RCV000503508
Germ cell tumor of testis	Benign	rs2295454	RCV005923785
Global developmental delay	Uncertain significance	rs780662350	RCV000503508
Hepatocellular carcinoma	Benign	rs2295454	RCV005923784
Hereditary cancer	Uncertain significance	rs375106070	RCV005602096
Hypertonia	Uncertain significance	rs780662350	RCV000498145
Intellectual disability	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	rs150119795, rs587778062, rs367744979, rs375094000, rs202098158, rs749495615	RCV001252411 RCV001252410 RCV005626529 RCV005626729 RCV001252174 RCV001252173
Moderate global developmental delay	Uncertain significance	rs780662350	RCV000498145
See cases	Uncertain significance	rs1479104382	RCV002252652
Seizure	Uncertain significance	rs780662350	RCV000498145
Uterine corpus endometrial carcinoma	Benign	rs73244991	RCV005916745

Show/Hide Text Mining Associations (138)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	26655088
Adrenocortical Carcinoma	Associate	34536950
Aging Premature	Associate	34210413
Anemia	Associate	32243522
Anemia Aplastic	Associate	25139356, 26132940, 34587721, 37087521
Anemia Hemolytic	Associate	35731275, 35766510
Anemia Refractory	Associate	20678218, 26874914
Arthritis Rheumatoid	Associate	34125889
Ataxia Telangiectasia	Associate	20334914
Atrial Fibrillation	Associate	35724849, 38598228
Atypical Squamous Cells of the Cervix	Associate	35352484
Bainbridge Ropers syndrome	Associate	27693232
Behcet Syndrome	Associate	36864496
Bjornstad syndrome	Associate	37558665
Blast Crisis	Associate	25850813
Bohring syndrome	Associate	22186017, 25921057, 31819025, 31969346, 33751773, 35119035, 35435261, 37053013, 39423952, 39614348
Bone Marrow Diseases	Associate	34529785
Brain Neoplasms	Associate	32374727
Breast Neoplasms	Associate	28055972, 28590426
Cancer Familial with In Vitro Radioresistance	Associate	35119035
Carcinoma Acinar Cell	Associate	32519264
Carcinoma Renal Cell	Associate	38043790
Cardiomyopathy infantile histiocytoid	Associate	27282351
Cell Transformation Viral	Associate	30683837
Cerebral Infarction	Associate	25426837
Chromosome 8 trisomy	Associate	35549661
Chronic Disease	Associate	35129130
Cirrhosis Familial	Associate	37558665
Colorectal Neoplasms	Associate	21209843, 28675510, 30804124, 34577783, 39984049
Congenital Abnormalities	Associate	27693232, 37053013
Coronary Artery Disease	Associate	39460851
Coronary Disease	Associate	34125889
Cyclic neutropenia	Associate	29866652, 34210413
Death	Associate	22271902, 24458439, 25596267
Developmental Disabilities	Associate	22287508, 39614348
Diabetic Angiopathies	Associate	32066200
Diffuse Intrinsic Pontine Glioma	Associate	28453743, 32680567
Down Syndrome	Associate	28590426
Drug Related Side Effects and Adverse Reactions	Associate	33877299, 35533245
Encephalitis Tick Borne	Associate	22031865
Epilepsy	Associate	31969346
Erdheim Chester Disease	Associate	31015311
Esophageal Squamous Cell Carcinoma	Associate	32375686
Essential Tremor	Associate	27447873
Fibrosis	Associate	27991718
GATA2 Deficiency	Associate	24077845, 34529785, 37103105
Genetic Diseases Inborn	Associate	22271902
Glioma	Associate	32680567
Granulomatous Disease Chronic	Associate	34596815
Heart Defects Congenital	Associate	37053013
Heart Failure	Associate	34210413
Hematologic Diseases	Associate	27717004, 28424163, 31350794, 37103105
Hematologic Neoplasms	Associate	27616637, 30222780, 34570179
Hip Injuries	Associate	36131041
Histiocytic Sarcoma	Associate	37839675
Histiocytosis Langerhans Cell	Associate	37839675
Hypereosinophilic Syndrome	Associate	27174585
Hypertrichosis	Associate	37053013
Hypotension	Stimulate	36485103
Inflammation	Associate	35533245
Intellectual Disability	Associate	31969346, 37053013
Intracranial Hemorrhages	Associate	33822276
Isodicentric Chromosome 15 Syndrome	Associate	36951163
Kidney Diseases	Associate	36282402
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	37846894
Leukemia	Associate	21712540, 24011025, 25326804, 27991718, 29532865, 32078680, 32683582, 34548471, 37591941
Leukemia Biphenotypic Acute	Associate	35200567
Leukemia Lymphocytic Chronic B Cell	Associate	24704113
Leukemia Mast Cell	Associate	28255023, 36094848
Leukemia Megakaryoblastic Acute	Associate	22122069
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21346257, 28452984, 29967129, 34570179, 35129130, 35902731, 36307398, 39327604, 40295826, 40344211
Leukemia Myeloid	Associate	21346257, 24077845, 24465546, 37053013, 39614348
Leukemia Myeloid Acute	Associate	20068184, 20678218, 20693432, 21712540, 21881046, 22031865, 22058207, 22371884, 22417203, 22507776, 22535592, 22581002, 22912701, 22929312, 23365461 View all (61 more)
Leukemia Myeloid Chronic Atypical BCR ABL Negative	Associate	28314085, 32573691, 33914911, 36601682, 37934881, 39337700
Leukemia Myeloid Chronic Phase	Associate	36307398, 40295826
Leukemia Myelomonocytic Chronic	Associate	19388938, 20408841, 20880116, 21828135, 23065512, 24077845, 24595958, 25555161, 25850813, 26648538, 26771811, 27385790, 27486981, 28548124, 28555081 View all (10 more)
Leukemia Myelomonocytic Juvenile	Associate	20408841, 20955399, 22773603, 38385260
Leukemia Neutrophilic Chronic	Associate	25850813, 31315541, 33822276, 34068566
Li Fraumeni Syndrome	Associate	37377903
Lung Diseases	Associate	39423952
Lung Neoplasms	Associate	24011025
Lymphoma	Associate	22287508, 25326804, 35533245
Lymphoma B Cell	Associate	35345371
Lymphoma Non Hodgkin	Associate	33689800
Mast Cell Activation Syndrome	Associate	24465546
Mastocytosis	Associate	22905207
Mastocytosis Systemic	Associate	22905207, 23958953, 24465546, 27214377, 28424161, 30152525, 30373888, 31151985, 31509472, 33391475, 37309222
Menkes Kinky Hair Syndrome	Associate	29417633
Myelodysplastic Myeloproliferative Diseases	Associate	21346257, 32573691, 35766510, 36594191, 39337700
Myelodysplastic Syndromes	Associate	19388938, 20334914, 20678218, 21714648, 23831921, 24115220, 24220272, 25092778, 25428262, 25574665, 26508027, 27527853, 27616637, 27717004, 27992414 View all (43 more)
Myeloproliferative Disorders	Associate	19388938, 27415155, 30004110
Myopathy with Giant Abnormal Mitochondria	Associate	33689800
Myopia	Associate	29346494
Neoplasm Metastasis	Associate	31173190
Neoplasms	Associate	18957548, 19388938, 20068184, 20408841, 21712540, 22271902, 22287508, 24704113, 24710217, 25426838, 25921057, 26416890, 26492932, 27449473, 28218607 View all (33 more)
Neoplasms Second Primary	Associate	28076841, 35803921
Neoplasms Squamous Cell	Associate	33687433, 34529129
Neural Tube Defects	Associate	22535592, 24077845, 25412851, 25860933, 29532865
Neuralgia	Associate	34202213
Neurotoxicity Syndromes	Associate	35533245
Neutropenia	Associate	24465546, 35766510
Obesity	Associate	31969346
Ovarian Neoplasms	Associate	30485824, 34963005, 36721777
Pancreatic Intraductal Neoplasms	Associate	27282351, 35238112, 36056133
Pancreatic Neoplasms	Associate	35238112
Pathological Conditions Anatomical	Associate	37053013
Peeling Skin Syndrome	Associate	22869879
Peritonitis	Associate	30804124
Persistent Fetal Circulation Syndrome	Associate	39423952
Philadelphia Chromosome	Associate	35129130
Plagiocephaly and X linked mental retardation	Associate	31969346
Polycythemia	Associate	38244120
Polycythemia Vera	Associate	21712540, 27447873, 27991718, 28419183, 32066200, 35435261, 37126762
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	31869410, 40295826
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	20880116, 27470916, 27476855, 32856987, 34492730, 35692075, 36281717
Primary Myelofibrosis	Associate	21712540, 23066032, 23996481, 24011025, 25252869, 27037840, 27447873, 28351937, 28419183, 28754985, 29515114, 29654267, 30683837, 32194289, 33666653 View all (5 more)
Prostatic Neoplasms Castration Resistant	Associate	22722839
Pruritus	Associate	33822276
Retinal Dysplasia	Associate	32216059
Segmentation syndrome 1	Associate	31819025
Shock Cardiogenic	Associate	35729851
Sialorrhea	Associate	35119035
Skeletal Defects Genital Hypoplasia And Mental Retardation	Associate	37053013
Skin Diseases	Associate	30373888
Spasms Infantile	Associate	35830182
Spinocerebellar Degenerations	Associate	28675510
Splenomegaly	Associate	30373888
ST Elevation Myocardial Infarction	Associate	40355940
Stroke	Associate	34507355
Thrombocythemia Essential	Associate	35301278
Thrombocytopenia	Associate	25850813, 30373888, 35731275
Thrombocytosis	Associate	21712540, 35129130
Thrombophilia	Associate	35733370
Thymoma	Associate	37749819
Tn Syndrome	Associate	36788093
Triple Negative Breast Neoplasms	Associate	28590426
Waldenstrom Macroglobulinemia	Associate	34847227, 37839675
Wilms Tumor	Associate	25921057, 28825729, 37053013, 37756569

ASXL1 (ASXL transcriptional regulator 1)