Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	170690
Gene name Gene Name - the full gene name approved by the HGNC.	ADAM metallopeptidase with thrombospondin type 1 motif 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADAMTS16
Synonyms (NCBI Gene) Gene synonyms aliases	ADAMTS16s
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p15.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018023	hsa-miR-335-5p	Microarray	18185580
MIRT766432	hsa-miR-1	CLIP-seq
MIRT766433	hsa-miR-1343	CLIP-seq
MIRT766434	hsa-miR-2052	CLIP-seq
MIRT766435	hsa-miR-206	CLIP-seq
MIRT766436	hsa-miR-296-3p	CLIP-seq
MIRT766437	hsa-miR-3065-3p	CLIP-seq
MIRT766438	hsa-miR-3171	CLIP-seq
MIRT766439	hsa-miR-3673	CLIP-seq
MIRT766440	hsa-miR-3687	CLIP-seq
MIRT766441	hsa-miR-4442	CLIP-seq
MIRT766442	hsa-miR-4490	CLIP-seq
MIRT766443	hsa-miR-4668-3p	CLIP-seq
MIRT766444	hsa-miR-4708-5p	CLIP-seq
MIRT766445	hsa-miR-4768-3p	CLIP-seq
MIRT766446	hsa-miR-4773	CLIP-seq
MIRT766447	hsa-miR-613	CLIP-seq
MIRT2167149	hsa-miR-128	CLIP-seq
MIRT2167150	hsa-miR-27a	CLIP-seq
MIRT2167151	hsa-miR-27b	CLIP-seq
MIRT2167152	hsa-miR-3155	CLIP-seq
MIRT2167153	hsa-miR-3155b	CLIP-seq
MIRT2167154	hsa-miR-4284	CLIP-seq
MIRT2167155	hsa-miR-484	CLIP-seq
MIRT2167156	hsa-miR-494	CLIP-seq
MIRT2425982	hsa-miR-142-5p	CLIP-seq
MIRT2425983	hsa-miR-216b	CLIP-seq
MIRT2425984	hsa-miR-3163	CLIP-seq
MIRT2425985	hsa-miR-4803	CLIP-seq
MIRT2425986	hsa-miR-548a-5p	CLIP-seq
MIRT2425987	hsa-miR-548ab	CLIP-seq
MIRT2425988	hsa-miR-548ak	CLIP-seq
MIRT2425989	hsa-miR-548b-5p	CLIP-seq
MIRT2425990	hsa-miR-548c-3p	CLIP-seq
MIRT2425991	hsa-miR-548c-5p	CLIP-seq
MIRT2425992	hsa-miR-548d-5p	CLIP-seq
MIRT2425993	hsa-miR-548h	CLIP-seq
MIRT2425994	hsa-miR-548i	CLIP-seq
MIRT2425995	hsa-miR-548j	CLIP-seq
MIRT2425996	hsa-miR-548k	CLIP-seq
MIRT2425997	hsa-miR-548l	CLIP-seq
MIRT2425998	hsa-miR-548w	CLIP-seq
MIRT2425999	hsa-miR-548y	CLIP-seq
MIRT2426000	hsa-miR-559	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0003073	Process	Regulation of systemic arterial blood pressure	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048232	Process	Male gamete generation	IEA
GO:1902017	Process	Regulation of cilium assembly	IEA

MIM	HGNC	e!Ensembl
607510	17108	ENSG00000145536

Protein

UniProt ID

Q8TE57

Protein name

A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAM-TS 16) (ADAM-TS16) (ADAMTS-16) (EC 3.4.24.-)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	61 → 205	Reprolysin family propeptide	Family
PF01421	Reprolysin	291 → 495	Reprolysin (M12B) family zinc metalloprotease	Domain
PF17771	ADAM_CR_2	508 → 575	ADAM cysteine-rich domain	Domain
PF00090	TSP_1	590 → 640	Thrombospondin type 1 domain	Domain
PF05986	ADAM_spacer1	746 → 858	ADAM-TS Spacer 1	Family
PF19030	TSP1_ADAMTS	931 → 986		Domain
PF19030	TSP1_ADAMTS	990 → 1047		Domain
PF19030	TSP1_ADAMTS	1055 → 1114		Domain
PF19030	TSP1_ADAMTS	1130 → 1180		Domain
PF08686	PLAC	1190 → 1220	PLAC (protease and lacunin) domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal lung and kidney and in adult prostate and ovary.

Sequence

MKPRARGWRGLAALWMLLAQVAEQAPACAMGPAAAAPGSPSVPRPPPPAERPGWMEKGEY
DLVSAYEVDHRGDYVSHEIMHHQRRRRAVPVSEVESLHLRLKGSRHDFHMDLRTSSSLVA
PGFIVQTLGKTGTKSVQTLPPEDFCFYQGSLRSHRNSSVALSTCQGLSGMIRTEEADYFL
RPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHSSDLRL
GLPQKQHFCGRRKKYMPQPPKEDLFILPDEYKSCLRHKRSLLRSHRNEELNVETLVVVDK
KMMQNHGHENITTYVLTILNMVSALFKDGTIGGNINIAIVGLILLEDEQPGLVISHHADH
TLSSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYRSCTIN
EDTGLGLAFTIAHESGHNFGMIHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSPCSRQYLH
KFLSTAQAICLADQPKPVKEYKYPEKLPGELYDANTQCKWQFGEKAKLCMLDFKKDICKA
LWCHRIGRKCETKFMPAAEGTICGHDMWCRGGQCVKYGDEGPKPTHGHWSDWSSWSPCSR
TCGGGVSHRSRLCTNPKPSHGGKFCEGSTRTLKLCNSQKCPRDSVDFRAAQCAEHNSRRF
RGRHYKWKPYTQVEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDGICERV
GCDNVLGSDAVEDVCGVCNGNNSACTIHRGLYTKHHHTNQYYHMVTIPSGARSIRIYEMN
VSTSYISVRNALRRYYLNGHWTVDWPGRYKFSGTTFDYRRSYNEPENLIATGPTNETLIV
ELLFQGRNPGVAWEYSMPRLGTEKQPPAQPSYTWAIVRSECSVSCGGGQMTVREGCYRDL
KFQVNMSFCNPKTRPVTGLVPCKVSACPPSWSVGNWSACSRTCGGGAQSRPVQCTRRVHY
DSEPVPASLCPQPAPSSRQACNSQSCPPAWSAGPWAECSHTCGKGWRKRAVACKSTNPSA
RAQLLPDAVCTSEPKPRMHEACLLQRCHKPKKLQWLVSAWSQCSVTCERGTQKRFLKCAE
KYVSGKYRELASKKCSHLPKPSLELERACAPLPCPRHPPFAAAGPSRGSWFASPWSQCTA
SCGGGVQTRSVQCLAGGRPASGCLLHQKPSASLACNTHFCPIAEKKDAFCKDYFHWCYLV
PQHGMCSHKFYGKQCCKTCSKSNL

Sequence length

1224

Interactions

View interactions

	Reactome
			Defective B3GALTL causes Peters-plus syndrome (PpS) O-glycosylation of TSR domain-containing proteins

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast cancer	Breast cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Associate	28088271
Abortion Spontaneous	Associate	28088271
Carcinogenesis	Associate	36232317
Chondrosarcoma	Associate	26181853
Colorectal Neoplasms	Associate	30081852
Esophageal Squamous Cell Carcinoma	Stimulate	20128818
Hernia Inguinal	Associate	35680855
Lung Neoplasms	Associate	30081852
Macular dystrophy retinal 1 North Carolina type	Associate	28790370
Neoplasms	Associate	30081852, 30239759, 36190948
Neoplasms	Stimulate	36232317
Osteoarthritis	Stimulate	14730609
Pain	Associate	29156912
Placenta Diseases	Associate	30239759
Premature Birth	Associate	30239759
Stomach Neoplasms	Associate	36232317
Urinary Incontinence	Associate	25524241

ADAMTS16 (ADAM metallopeptidase with thrombospondin type 1 motif 16)