Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	170589
Gene name Gene Name - the full gene name approved by the HGNC.	Glycoprotein hormone subunit alpha 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPHA2
Synonyms (NCBI Gene) Gene synonyms aliases	A2, GPA2, ZSIG51
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 [PubMed 12089349]).[supplied by OMIM, Mar 2008]

Show/Hide all(71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT649023	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT649022	hsa-miR-764	HITS-CLIP	23824327
MIRT649021	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT649019	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT649020	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT649018	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT649017	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT649016	hsa-miR-1266-5p	HITS-CLIP	23824327
MIRT649015	hsa-miR-4518	HITS-CLIP	23824327
MIRT649014	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT649013	hsa-miR-3185	HITS-CLIP	23824327
MIRT649012	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT460403	hsa-miR-4476	PAR-CLIP	23592263
MIRT460402	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT460401	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT460400	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT460399	hsa-miR-1180-5p	PAR-CLIP	23592263
MIRT460398	hsa-miR-7114-3p	PAR-CLIP	23592263
MIRT460397	hsa-miR-4533	PAR-CLIP	23592263
MIRT460396	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT460394	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT460395	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT460393	hsa-miR-7973	PAR-CLIP	23592263
MIRT460392	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT649023	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT649022	hsa-miR-764	HITS-CLIP	23824327
MIRT649021	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT649019	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT649020	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT649018	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT649017	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT649016	hsa-miR-1266-5p	HITS-CLIP	23824327
MIRT649015	hsa-miR-4518	HITS-CLIP	23824327
MIRT649014	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT649013	hsa-miR-3185	HITS-CLIP	23824327
MIRT649012	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT460403	hsa-miR-4476	PAR-CLIP	23592263
MIRT460402	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT460401	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT460400	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT460399	hsa-miR-1180-5p	PAR-CLIP	23592263
MIRT460398	hsa-miR-7114-3p	PAR-CLIP	23592263
MIRT460397	hsa-miR-4533	PAR-CLIP	23592263
MIRT460396	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT460394	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT460395	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT460393	hsa-miR-7973	PAR-CLIP	23592263
MIRT460392	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT1029283	hsa-miR-1272	CLIP-seq
MIRT1029284	hsa-miR-3662	CLIP-seq
MIRT1029285	hsa-miR-583	CLIP-seq
MIRT2237992	hsa-miR-1207-5p	CLIP-seq
MIRT2237993	hsa-miR-145	CLIP-seq
MIRT2237994	hsa-miR-1827	CLIP-seq
MIRT2237995	hsa-miR-2467-3p	CLIP-seq
MIRT2237996	hsa-miR-3127-5p	CLIP-seq
MIRT2237997	hsa-miR-3154	CLIP-seq
MIRT2237998	hsa-miR-3667-3p	CLIP-seq
MIRT2237999	hsa-miR-3918	CLIP-seq
MIRT2238000	hsa-miR-4328	CLIP-seq
MIRT2238001	hsa-miR-4446-3p	CLIP-seq
MIRT2238002	hsa-miR-4448	CLIP-seq
MIRT2238003	hsa-miR-4514	CLIP-seq
MIRT2238004	hsa-miR-4640-5p	CLIP-seq
MIRT2238005	hsa-miR-4645-5p	CLIP-seq
MIRT2238006	hsa-miR-4673	CLIP-seq
MIRT2238007	hsa-miR-4692	CLIP-seq
MIRT2238008	hsa-miR-4726-5p	CLIP-seq
MIRT2238009	hsa-miR-4755-3p	CLIP-seq
MIRT2238010	hsa-miR-4763-3p	CLIP-seq
MIRT2238011	hsa-miR-940	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	12045258
GO:0005576	Component	Extracellular region	IDA	12089349
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	12045258
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	12045258
GO:0031531	Function	Thyrotropin-releasing hormone receptor binding	IBA	21873635
GO:0031531	Function	Thyrotropin-releasing hormone receptor binding	IMP	12045258
GO:0046982	Function	Protein heterodimerization activity	IDA	12045258
GO:0051427	Function	Hormone receptor binding	IBA	21873635

MIM	HGNC	e!Ensembl
609651	18054	ENSG00000149735

Protein

UniProt ID

Q96T91

Protein name

Glycoprotein hormone alpha-2 (Putative secreted protein Zsig51) (Thyrostimulin subunit alpha)

Protein function

Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production (PubMed:12045258). Plays a central role in controlling thyroid cell meta

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03045	DAN	16 → 124	DAN domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in a variety of tissues. {ECO:0000269|PubMed:12089349}.

Sequence

MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGH
CESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQ
CDMCRLSRY

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction		Hormone ligand-binding receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	22535842

Show/Hide Text Mining Associations (57)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma Mucinous	Associate	1928301
alpha Thalassemia	Associate	14508795, 14587048, 23368878, 23614625, 2473806, 25730315, 26377141, 31060505, 31478238, 34247821, 3680504, 36902239, 3771577, 6255436, 6894931, 6946451, 8611658, 8781536 View all (3 more)
Alzheimer Disease	Associate	22691495
Anemia Hemolytic	Associate	9029003
Anemia Sickle Cell	Associate	1177281, 3337900, 8781536
Anodontia	Associate	8781536
Arthritis Rheumatoid	Associate	2510617
Asthma	Associate	23160057
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Associate	17900292
beta Thalassemia	Associate	2473806, 36902239
Blood Platelet Disorders	Associate	10449749, 30545930
Breast Neoplasms	Associate	18787945, 22644305, 26903292
Breast Neoplasms	Inhibit	8276836
Carcinoma Hepatocellular	Associate	34559939
Carcinoma Squamous Cell	Associate	18398683
Cholangiocarcinoma	Associate	31795149
Colorectal Neoplasms	Inhibit	15063740, 37116137
Crohn Disease	Associate	10623652
Diabetes Mellitus Type 2	Associate	33426802
Diabetic Nephropathies	Inhibit	22343787
Drug Resistant Epilepsy	Associate	24613745
Epstein Barr Virus Infections	Associate	16448567
Fabry Disease	Associate	23614625
Genetic Diseases Inborn	Associate	21552571
Glioblastoma	Stimulate	34207114
Graves Ophthalmopathy	Associate	34889904
Hemoglobin C Disease	Associate	23368878
Hemoglobinopathies	Associate	2981252
Hydrops Fetalis	Associate	20642338
Idiopathic Pulmonary Fibrosis	Associate	26006016
IgA Deficiency	Associate	19153537
Immunoglobulin G4 Related Disease	Associate	8421065
Infections	Associate	17360739
Lung Neoplasms	Associate	29129073, 8385084
Malformations of Cortical Development	Associate	24613745
Marfan Syndrome	Associate	6950413
Melanoma	Associate	8868467
Mouth Diseases	Associate	26006016
Myocardial Infarction	Associate	15978110
Neoplasm Invasiveness	Associate	9223755
Neoplasms	Associate	10973658, 24018448, 26903292, 27129262, 29129073, 29434218, 29475939, 34559939
Neoplasms	Inhibit	15063740
Neoplasms	Stimulate	20345175
Nephritis Hereditary	Associate	1635341
Neuralgia	Associate	35462614
Ovarian Neoplasms	Associate	28358117
Philadelphia Chromosome	Associate	9326250
Post Infectious Disorders	Associate	16448567
Prion Diseases	Associate	21552571
Prostatic Neoplasms	Associate	23242739, 25137483
Pulmonary Disease Chronic Obstructive	Associate	34290711
Squamous Cell Carcinoma of Head and Neck	Associate	36289103
Status Asthmaticus	Associate	23160057
Status Epilepticus	Associate	24613745
Stomach Neoplasms	Associate	33947960
Stroke	Associate	10339462
Urinary Bladder Neoplasms	Associate	8178925

GPHA2 (glycoprotein hormone subunit alpha 2)