HTR3C (5-hydroxytryptamine receptor 3C)

Gene

• Entrez ID: 170572
• Gene name: 5-hydroxytryptamine receptor 3C
• Gene symbol: HTR3C
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit C of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1057256	hsa-miR-1202	CLIP-seq
MIRT1057257	hsa-miR-3972	CLIP-seq
MIRT1057258	hsa-miR-4776-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17392525
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	17392525
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0098662	Process	Inorganic cation transmembrane transport	IEA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IBA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	17392525
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	17392525

Other IDs

• MIM: 610121
• HGNC: 24003
• e!Ensembl: ENSG00000178084

Protein

• UniProt ID: Q8WXA8
• Protein name: 5-hydroxytryptamine receptor 3C (5-HT3-C) (5-HT3C) (Serotonin receptor 3C)
• Protein function: Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	44 → 247	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	254 → 373	Neurotransmitter-gated ion-channel transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many tissues including adult brain, colon, intestine, lung, muscle and stomach as well as fetal colon and kidney. {ECO:0000269|PubMed:12801637}.
• Sequence:

  MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNY
  SIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENL
  WLPDIFIVESMDVDQTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF
  SSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFY
  VAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLL
  PASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLLHCTSPGRC
  CPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH
  AMDTLLFRLYLLFMASSILTVIVLWNT

• Sequence length: 447

Pathways

KEGG:

Serotonergic synapse
Taste transduction

Reactome:

Neurotransmitter receptors and postsynaptic signal transmission