OIT3 (oncoprotein induced transcript 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 170392
Gene name Oncoprotein induced transcript 3
Gene symbol OIT3
Synonyms (NCBI Gene)
LZP
Chromosome 10
Chromosome location 10q22.1
Summary This gene was identified due to its downregulation in hepatocarcinomas. The encoded protein may be involved in liver development and function. [provided by RefSeq, Sep 2016]
miRNA miRNA information provided by mirtarbase database.
17
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (17)
miRTarBase ID miRNA Experiments Reference
MIRT449981 hsa-miR-296-3p PAR-CLIP 22100165
MIRT449980 hsa-miR-5087 PAR-CLIP 22100165
MIRT449979 hsa-miR-203a-3p PAR-CLIP 22100165
MIRT449981 hsa-miR-296-3p PAR-CLIP 22100165
MIRT449980 hsa-miR-5087 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0003014 Process Renal system process IEA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005615 Component Extracellular space IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609330 29953 ENSG00000138315
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWZ8
Protein name Oncoprotein-induced transcript 3 protein (Liver-specific zona pellucida domain-containing protein)
Protein function May be involved in hepatocellular function and development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14670 FXa_inhibition 186 → 221 Domain
PF14670 FXa_inhibition 227 → 262 Domain
PF00100 Zona_pellucida 268 → 514 Zona pellucida-like domain Family
Tissue specificity TISSUE SPECIFICITY: Liver-specific. Expressed only in the hepatocytes. Down-regulated in hepatocellular carcinoma (HCC) and HCC cell lines. {ECO:0000269|PubMed:12939600}.
Sequence 
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDVEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIR
IDWED
Sequence length 545
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs145480078 RCV000205640
Show/Hide Text Mining Associations (8)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 35353239
Carcinoma Hepatocellular Associate 35353239
Gout Associate 32569156
Idiopathic Noncirrhotic Portal Hypertension Associate 40321824
Juvenile gout Associate 15589826
Neoplasm Metastasis Associate 35353239
Neoplasms Associate 35353239
Pancreatic Neoplasms Associate 25824785