OIT3 (oncoprotein induced transcript 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
170392
Gene name Gene Name - the full gene name approved by the HGNC.
Oncoprotein induced transcript 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OIT3
Synonyms (NCBI Gene) Gene synonyms aliases
LZP
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was identified due to its downregulation in hepatocarcinomas. The encoded protein may be involved in liver development and function. [provided by RefSeq, Sep 2016]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(17)
miRTarBase ID miRNA Experiments Reference
MIRT449981 hsa-miR-296-3p PAR-CLIP 22100165
MIRT449980 hsa-miR-5087 PAR-CLIP 22100165
MIRT449979 hsa-miR-203a-3p PAR-CLIP 22100165
MIRT449981 hsa-miR-296-3p PAR-CLIP 22100165
MIRT449980 hsa-miR-5087 PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005201 Function Extracellular matrix structural constituent IBA 21873635
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005615 Component Extracellular space IBA 21873635
GO:0005635 Component Nuclear envelope IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609330 29953 ENSG00000138315
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8WWZ8
Protein name Oncoprotein-induced transcript 3 protein (Liver-specific zona pellucida domain-containing protein)
Protein function May be involved in hepatocellular function and development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14670 FXa_inhibition 186 → 221 Domain
PF14670 FXa_inhibition 227 → 262 Domain
PF00100 Zona_pellucida 268 → 514 Zona pellucida-like domain Family
Tissue specificity TISSUE SPECIFICITY: Liver-specific. Expressed only in the hepatocytes. Down-regulated in hepatocellular carcinoma (HCC) and HCC cell lines. {ECO:0000269|PubMed:12939600}.
Sequence 
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDVEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIR
IDWED
Sequence length 545
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Coronary artery disease Coronary artery disease GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 35353239
Carcinoma Hepatocellular Associate 35353239
Gout Associate 32569156
Idiopathic Noncirrhotic Portal Hypertension Associate 40321824
Juvenile gout Associate 15589826
Neoplasm Metastasis Associate 35353239
Neoplasms Associate 35353239
Pancreatic Neoplasms Associate 25824785