DEFA4 (defensin alpha 4)

Gene

• Entrez ID: 1669
• Gene name: Defensin alpha 4
• Gene symbol: DEFA4
• Synonyms (NCBI Gene): DEF4, HNP-4, HP-4, HP4
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017503	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006952	Process	Defense response	IEA
GO:0010818	Process	T cell chemotaxis	IDA	17088326
GO:0019730	Process	Antimicrobial humoral response	IDA	2500436
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	2500436
GO:0019732	Process	Antifungal humoral response	IDA	2500436
GO:0030133	Component	Transport vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	15616305, 17088326
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042582	Component	Azurophil granule	IDA	2500436
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	17088326
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	2500436
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	2500436
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	2500436
GO:0050832	Process	Defense response to fungus	IDA	2500436
GO:0050832	Process	Defense response to fungus	IEA
GO:0051673	Process	Disruption of plasma membrane integrity in another organism	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IC	15616305, 17088326
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	2500436
GO:0140911	Function	Pore-forming activity	IBA

Other IDs

• MIM: 601157
• HGNC: 2763
• e!Ensembl: ENSG00000164821

Protein

• UniProt ID: P12838
• Protein name: Defensin alpha 4 (Corticostatin HP-4) (HNP-4) (HP-4) (Neutrophil defensin 4)
• Protein function: Host-defense peptide that has antimicrobial activity against Gram-negative bacteria, and to a lesser extent also against Gram-positive bacteria and fungi (PubMed:15317502, PubMed:15616305, PubMed:2500436, PubMed:2501794, PubMed:30658057). Exhibi
• PDB: 1ZMM, 6DMM, 6DMQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00879	Defensin_propep	1 → 51	Defensin propeptide	Family
  PF00323	Defensin_1	65 → 93	Mammalian defensin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neutrophils (at protein level) (PubMed:2500436, PubMed:2501794, PubMed:2843187). Expressed in bone marrow (PubMed:8469233). {ECO:0000269|PubMed:2500436, ECO:0000269|PubMed:2501794, ECO:0000269|PubMed:2843187, ECO:0000269|P
• Sequence:

  MRIIALLAAILLVALQVRAGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGST
  RGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD

• Sequence length: 97

Pathways

KEGG:

NOD-like receptor signaling pathway
Staphylococcus aureus infection
Transcriptional misregulation in cancer

Reactome:

Defensins
Alpha-defensins
Neutrophil degranulation