Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1663
Gene name	DEAD/H-box helicase 11
Gene symbol	DDX11
Synonyms (NCBI Gene)	CHL1CHLR1KRG2WABS
Chromosome	12
Chromosome location	12p11.21
Summary	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs148856317	G>C	Pathogenic, likely-pathogenic	Splice acceptor variant
rs201968272	G>A	Pathogenic	Non coding transcript variant, missense variant, 5 prime UTR variant, coding sequence variant
rs368266910	G>A,C,T	Uncertain-significance, pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs730880279	T>C	Pathogenic	Splice donor variant, intron variant, genic downstream transcript variant
rs730880280	AAG>-	Pathogenic	Coding sequence variant, 3 prime UTR variant, non coding transcript variant, genic downstream transcript variant, inframe deletion
rs745501673	G>A,T	Pathogenic	Splice donor variant, downstream transcript variant, intron variant, genic downstream transcript variant
rs776627170	C>T	Likely-pathogenic	Non coding transcript variant, stop gained, 3 prime UTR variant, genic downstream transcript variant, coding sequence variant
rs779058797	G>A	Likely-pathogenic	Downstream transcript variant, splice acceptor variant, non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs781413815	C>G,T	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, non coding transcript variant, upstream transcript variant, missense variant, stop gained, coding sequence variant
rs1359896342	C>A,T	Likely-pathogenic	5 prime UTR variant, upstream transcript variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant, stop gained, intron variant, missense variant
rs1565941025	T>G	Conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, 3 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043115	hsa-miR-324-5p	CLASH	23622248
MIRT040191	hsa-miR-615-3p	CLASH	23622248
MIRT037623	hsa-miR-744-5p	CLASH	23622248
MIRT461763	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT461761	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT461762	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT461760	hsa-miR-4476	PAR-CLIP	23592263
MIRT461759	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT461758	hsa-miR-4779	PAR-CLIP	23592263
MIRT461757	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT461756	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT461755	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT461754	hsa-miR-4533	PAR-CLIP	23592263
MIRT461753	hsa-miR-765	PAR-CLIP	23592263
MIRT461752	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT461751	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT461750	hsa-miR-4271	PAR-CLIP	23592263
MIRT461749	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT461748	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT461747	hsa-miR-4504	PAR-CLIP	23592263
MIRT461763	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT461761	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT461762	hsa-miR-510-5p	PAR-CLIP	23592263
MIRT461760	hsa-miR-4476	PAR-CLIP	23592263
MIRT461759	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT461758	hsa-miR-4779	PAR-CLIP	23592263
MIRT461757	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT461756	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT461755	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT461754	hsa-miR-4533	PAR-CLIP	23592263
MIRT461753	hsa-miR-765	PAR-CLIP	23592263
MIRT461752	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT461751	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT461750	hsa-miR-4271	PAR-CLIP	23592263
MIRT461749	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT461748	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT461747	hsa-miR-4504	PAR-CLIP	23592263
MIRT929646	hsa-miR-125a-5p	CLIP-seq
MIRT929647	hsa-miR-125b	CLIP-seq
MIRT929648	hsa-miR-140-3p	CLIP-seq
MIRT929649	hsa-miR-1827	CLIP-seq
MIRT929650	hsa-miR-2355-3p	CLIP-seq
MIRT929651	hsa-miR-2392	CLIP-seq
MIRT929652	hsa-miR-2467-3p	CLIP-seq
MIRT929653	hsa-miR-2861	CLIP-seq
MIRT929654	hsa-miR-298	CLIP-seq
MIRT929655	hsa-miR-3157-5p	CLIP-seq
MIRT929656	hsa-miR-326	CLIP-seq
MIRT929657	hsa-miR-330-5p	CLIP-seq
MIRT929658	hsa-miR-3653	CLIP-seq
MIRT929659	hsa-miR-3688-3p	CLIP-seq
MIRT929660	hsa-miR-3978	CLIP-seq
MIRT929661	hsa-miR-4319	CLIP-seq
MIRT929662	hsa-miR-4436b-3p	CLIP-seq
MIRT929663	hsa-miR-4459	CLIP-seq
MIRT929664	hsa-miR-4646-3p	CLIP-seq
MIRT929665	hsa-miR-4667-5p	CLIP-seq
MIRT929666	hsa-miR-4691-3p	CLIP-seq
MIRT929667	hsa-miR-4700-5p	CLIP-seq
MIRT929668	hsa-miR-4722-5p	CLIP-seq
MIRT929669	hsa-miR-4732-3p	CLIP-seq
MIRT929670	hsa-miR-4768-5p	CLIP-seq
MIRT929671	hsa-miR-541	CLIP-seq
MIRT929672	hsa-miR-615-5p	CLIP-seq
MIRT929673	hsa-miR-637	CLIP-seq
MIRT929674	hsa-miR-665	CLIP-seq
MIRT929675	hsa-miR-670	CLIP-seq
MIRT929676	hsa-miR-760	CLIP-seq
MIRT1975254	hsa-miR-1909	CLIP-seq
MIRT1975255	hsa-miR-214	CLIP-seq
MIRT1975256	hsa-miR-3619-5p	CLIP-seq
MIRT1975257	hsa-miR-4291	CLIP-seq
MIRT1975258	hsa-miR-4688	CLIP-seq
MIRT1975259	hsa-miR-486-3p	CLIP-seq
MIRT1975260	hsa-miR-761	CLIP-seq
MIRT1975261	hsa-miR-922	CLIP-seq
MIRT2514558	hsa-miR-1207-5p	CLIP-seq
MIRT2514559	hsa-miR-1252	CLIP-seq
MIRT2514560	hsa-miR-1302	CLIP-seq
MIRT2514561	hsa-miR-138	CLIP-seq
MIRT2514562	hsa-miR-149	CLIP-seq
MIRT2514563	hsa-miR-1539	CLIP-seq
MIRT2514564	hsa-miR-1976	CLIP-seq
MIRT2514565	hsa-miR-22	CLIP-seq
MIRT2514566	hsa-miR-302f	CLIP-seq
MIRT2514567	hsa-miR-3064-3p	CLIP-seq
MIRT929655	hsa-miR-3157-5p	CLIP-seq
MIRT2514568	hsa-miR-3193	CLIP-seq
MIRT2514569	hsa-miR-337-5p	CLIP-seq
MIRT2514570	hsa-miR-4298	CLIP-seq
MIRT2514571	hsa-miR-4446-3p	CLIP-seq
MIRT2514572	hsa-miR-4462	CLIP-seq
MIRT2514573	hsa-miR-4485	CLIP-seq
MIRT2514574	hsa-miR-4514	CLIP-seq
MIRT2514575	hsa-miR-4642	CLIP-seq
MIRT2514576	hsa-miR-4645-5p	CLIP-seq
MIRT2514577	hsa-miR-4648	CLIP-seq
MIRT2514578	hsa-miR-4654	CLIP-seq
MIRT2514579	hsa-miR-4673	CLIP-seq
MIRT2514580	hsa-miR-4675	CLIP-seq
MIRT929666	hsa-miR-4691-3p	CLIP-seq
MIRT2514581	hsa-miR-4692	CLIP-seq
MIRT2514582	hsa-miR-4694-5p	CLIP-seq
MIRT2514583	hsa-miR-4741	CLIP-seq
MIRT2514584	hsa-miR-4763-3p	CLIP-seq
MIRT2514585	hsa-miR-4769-5p	CLIP-seq
MIRT2514586	hsa-miR-4786-5p	CLIP-seq
MIRT2514587	hsa-miR-602	CLIP-seq
MIRT2514588	hsa-miR-658	CLIP-seq
MIRT2514589	hsa-miR-671-5p	CLIP-seq
MIRT929676	hsa-miR-760	CLIP-seq
MIRT2514590	hsa-miR-940	CLIP-seq
MIRT2514558	hsa-miR-1207-5p	CLIP-seq
MIRT2514559	hsa-miR-1252	CLIP-seq
MIRT2514560	hsa-miR-1302	CLIP-seq
MIRT2514562	hsa-miR-149	CLIP-seq
MIRT929655	hsa-miR-3157-5p	CLIP-seq
MIRT2514570	hsa-miR-4298	CLIP-seq
MIRT2514571	hsa-miR-4446-3p	CLIP-seq
MIRT2514574	hsa-miR-4514	CLIP-seq
MIRT2514576	hsa-miR-4645-5p	CLIP-seq
MIRT2514577	hsa-miR-4648	CLIP-seq
MIRT2514578	hsa-miR-4654	CLIP-seq
MIRT2514579	hsa-miR-4673	CLIP-seq
MIRT2514580	hsa-miR-4675	CLIP-seq
MIRT929666	hsa-miR-4691-3p	CLIP-seq
MIRT2514581	hsa-miR-4692	CLIP-seq
MIRT2514583	hsa-miR-4741	CLIP-seq
MIRT2514584	hsa-miR-4763-3p	CLIP-seq
MIRT2514585	hsa-miR-4769-5p	CLIP-seq
MIRT2514589	hsa-miR-671-5p	CLIP-seq
MIRT929676	hsa-miR-760	CLIP-seq
MIRT2514590	hsa-miR-940	CLIP-seq

Show/Hide all (68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000785	Component	Chromatin	IDA	17105772
GO:0000922	Component	Spindle pole	IDA	17105772
GO:0000922	Component	Spindle pole	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IDA	26503245
GO:0003677	Function	DNA binding	IEA
GO:0003678	Function	DNA helicase activity	IBA
GO:0003678	Function	DNA helicase activity	IDA	26503245
GO:0003678	Function	DNA helicase activity	IEA
GO:0003682	Function	Chromatin binding	IDA	26503245
GO:0003682	Function	Chromatin binding	IMP	20124417, 26089203, 27477908
GO:0003688	Function	DNA replication origin binding	IMP	27477908
GO:0003690	Function	Double-stranded DNA binding	IDA	9013641
GO:0003697	Function	Single-stranded DNA binding	IDA	9013641
GO:0003723	Function	RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IDA	27477908
GO:0004386	Function	Helicase activity	IDA	10648783, 18499658
GO:0004386	Function	Helicase activity	IEA
GO:0004386	Function	Helicase activity	TAS	8798685
GO:0005515	Function	Protein binding	IPI	17105772, 17189189, 18499658, 20124417, 26089203, 33961781, 34819669
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17189189
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	9013641, 26089203
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17105772
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006139	Process	Nucleobase-containing compound metabolic process	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	23797032
GO:0007062	Process	Sister chromatid cohesion	IDA	17105772
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	10648783, 26503245
GO:0008094	Function	ATP-dependent activity, acting on DNA	IMP	26089203
GO:0008186	Function	ATP-dependent activity, acting on RNA	IDA	27477908
GO:0016787	Function	Hydrolase activity	IEA
GO:0016818	Function	Hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030496	Component	Midbody	IDA	17105772
GO:0030496	Component	Midbody	IEA
GO:0030892	Component	Mitotic cohesin complex	IDA	17105772
GO:0031297	Process	Replication fork processing	IMP	26503245
GO:0032091	Process	Negative regulation of protein binding	IMP	26089203
GO:0034085	Process	Establishment of sister chromatid cohesion	IBA
GO:0035563	Process	Positive regulation of chromatin binding	IDA	26089203
GO:0043139	Function	5'-3' DNA helicase activity	IDA	18499658
GO:0045142	Function	Triplex DNA binding	IDA	26503245
GO:0045876	Process	Positive regulation of sister chromatid cohesion	IMP	18499658, 20124417, 27477908
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IEA
GO:0051880	Function	G-quadruplex DNA binding	IDA	26503245
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0072711	Process	Cellular response to hydroxyurea	IMP	23797032, 26503245
GO:0072719	Process	Cellular response to cisplatin	IMP	23797032
GO:0140640	Function	Catalytic activity, acting on a nucleic acid	IDA	26503245
GO:1901838	Process	Positive regulation of transcription of nucleolar large rRNA by RNA polymerase I	IMP	26089203
GO:1904976	Process	Cellular response to bleomycin	IMP	23797032
GO:1990700	Process	Nucleolar chromatin organization	IMP	26089203
GO:2000781	Process	Positive regulation of double-strand break repair	IMP	23797032

MIM	HGNC	e!Ensembl
601150	2736	ENSG00000013573

Q96FC9

Protein name

ATP-dependent DNA helicase DDX11 (EC 5.6.2.3) (CHL1-related protein 1) (hCHLR1) (DEAD/H-box protein 11) (DNA 5'-3' helicase DDX11) (Keratinocyte growth factor-regulated gene 2 protein) (KRG-2)

Protein function

DNA-dependent ATPase and ATP-dependent DNA helicase that participates in various functions in genomic stability, including DNA replication, DNA repair and heterochromatin organization as well as in ribosomal RNA synthesis (PubMed:10648783, PubMe

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06733	DEAD_2	231 → 415	DEAD_2	Family
PF13307	Helicase_C_2	692 → 850	Helicase C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in melanoma cells. Not detected in epidermal melanocytes of normal skin (at protein level) (PubMed:23116066). Highly expressed in spleen, B-cells, thymus, testis, ovary, small intestine and pancreas (PubMed:9013641). Very low

Sequence

MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSLICGALS
WLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQK
KEERDLVDRLKAEQARRKQREERLQQLQHRVQLKYAAKRLRQEEEERENLLRLSREMLET
GPEAERLEQLESGEEELVLAEYESDEEKKVASRVDEDEDDLEEEHITKIYYCSRTHSQLA
QFVHEVKKSPFGKDVRLVSLGSRQNLCVNEDVKSLGSVQLINDRCVDMQRSRHEKKKGAE
EEKPKRRRQEKQAACPFYNHEQMGLLRDEALAEVKDMEQLLALGKEARACPYYGSRLAIP
AAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDTITGMHSVEVSGSQLCQAHS
QLLQYVERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQTGTELKTIND
FLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQPR
TTEALAAPADESQASTLRPASPLMHIQGFLAALTTANQDGRVILSRQGSLSQSTLKFLLL
NPAVHFAQVVKECRAVVIAGGTMQPVSDFRQQLLACAGVEAERVVEFSCGHVIPPDNILP
LVICSGISNQPLEFTFQKRELPQMMDEVGRILCNLCGVVPGGVVCFFPSYEYLRQVHAHW
EKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGALLLSVVGGKMS
EGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLSPRPGTPREGSGGEPVHEGRQ
PVHRQGHQAPEGFCQRSAPGPAICPAPCPGQAAGLDPSPCGGQSYLWPRHCCCAEVSPGE
VGLFLMGNHTTAWRRALPLSCPLETVFVVGVVCGDPVTKVKPRRRVWSPECCQDPGTGVS
SRRRKWGNPE

Sequence length

970

Interactions

View interactions

	KEGG		Reactome
	Cell cycle		XBP1(S) activates chaperone genes

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cervical cancer	Likely pathogenic; Pathogenic	rs201968272	RCV005888878
Clear cell carcinoma of kidney	Pathogenic	rs148856317	RCV005891059
DDX11-related condition	Pathogenic	rs148856317	RCV004758676
Glioma susceptibility 1	Likely pathogenic; Pathogenic	rs201968272	RCV005888877
Sarcoma	Pathogenic; Likely pathogenic	rs148856317, rs201968272	RCV005891060 RCV005888879
Uterine carcinosarcoma	Pathogenic	rs148856317	RCV005891061
Warsaw breakage syndrome	Likely pathogenic; Pathogenic	rs1946792293, rs1944933634, rs1946656233, rs774867268, rs766120336, rs730880279, rs730880280, rs148856317, rs752448493, rs779058797, rs368266910, rs201968272, rs780059558, rs745501673, rs776627170 View all (3 more)	RCV001330070 RCV001333269 RCV001334282 RCV005005962 RCV002272904 RCV000008874 RCV000008875 RCV000991173 RCV003405145 RCV005010305 RCV000762793 RCV000033122 RCV000709978 RCV000791059 RCV003223415 RCV001170038 RCV001280920 RCV001280798

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Uncertain significance	rs71455621, rs376819535	RCV005906655 RCV005920747
Cholangiocarcinoma	Uncertain significance; Benign	rs2911826, rs71455621	RCV005893681 RCV005906661
Familial cancer of breast	Uncertain significance	rs147656831	RCV005931744
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	rs2911826	RCV005893680
Microcephaly	Uncertain significance	rs759123212	RCV001252792
Ovarian serous cystadenocarcinoma	Benign	rs71455621	RCV005906659
Thymoma	Benign	rs71455621	RCV005906660
Uterine corpus endometrial carcinoma	Benign	rs71455621	RCV005906662

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35237359
Breast Neoplasms	Associate	35169864
Carcinogenesis	Associate	28496001, 32054332
Carcinoma Hepatocellular	Associate	28496001, 29599483, 33592832, 34603293, 39849389
Chromosomal Instability	Associate	26503245
Chromosome Breakage	Associate	20137776, 23797032
Cochlear Diseases	Associate	30216658
Cockayne Syndrome	Associate	23935105
Congenital Abnormalities	Associate	23033317
De Lange Syndrome	Associate	20137776
Dyskeratosis Congenita	Associate	23935105
Esophageal Neoplasms	Stimulate	34281459
Esophageal Squamous Cell Carcinoma	Associate	34866524
Fanconi Anemia	Associate	20137776, 22102414
Genetic Diseases Inborn	Associate	22102414, 26474416
Glioma	Associate	30984540
Growth Disorders	Associate	23033317
Immunologic Deficiency Syndromes	Inhibit	22102414
Immunologic Deficiency Syndromes	Associate	22102414
Intellectual Disability	Associate	23033317
Leukemia Myeloid Acute	Associate	37041565
Lupus Erythematosus Systemic	Associate	34299244
Lymphatic Metastasis	Stimulate	32054332
Lymphedema Congenital Recessive	Associate	23033317
Melanoma	Associate	23116066
Microcephaly	Associate	23033317, 30216658
Microphthalmia Syndromic 6	Associate	23797032
Myelodysplastic Syndromes	Associate	37041565
Neoplasm Invasiveness	Stimulate	23116066
Neoplasms	Associate	34866524, 36474250, 37041565, 38478595
Roberts Syndrome	Associate	20137776
Skin Abnormalities	Associate	23033317
Stomach Neoplasms	Associate	32054332, 32271422
Xeroderma Pigmentosum	Associate	23935105

DDX11 (DEAD/H-box helicase 11)