Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1655
Gene name Gene Name - the full gene name approved by the HGNC.
DEAD-box helicase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DDX5
Synonyms (NCBI Gene) Gene synonyms aliases
G17P1, HLR1, HUMP68, p68
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved i
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003236 hsa-miR-205-5p Luciferase reporter assay 20065103
MIRT002799 hsa-miR-1-3p pSILAC 18668040
MIRT002799 hsa-miR-1-3p Microarray 15685193
MIRT019588 hsa-miR-340-5p Sequencing 20371350
MIRT020195 hsa-miR-130b-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 15298701
GO:0000166 Function Nucleotide binding IEA
GO:0000380 Process Alternative mRNA splicing, via spliceosome IBA
GO:0000380 Process Alternative mRNA splicing, via spliceosome IMP 24275493, 24910439
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IDA 21343338
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
180630 2746 ENSG00000108654
Protein
UniProt ID P17844
Protein name Probable ATP-dependent RNA helicase DDX5 (EC 3.6.4.13) (DEAD box protein 5) (RNA helicase p68)
Protein function Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon
PDB 3FE2 , 4A4D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00270 DEAD 118 289 DEAD/DEAH box helicase Domain
PF00271 Helicase_C 324 436 Helicase conserved C-terminal domain Family
PF08061 P68HR 498 532 P68HR (NUC004) repeat Repeat
PF08061 P68HR 551 583 P68HR (NUC004) repeat Repeat
Sequence
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQL
AEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARST
KTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAA
APMIGYPMPTGYSQ
Sequence length 614
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome
Transcriptional misregulation in cancer
Proteoglycans in cancer
  SUMOylation of transcription cofactors
mRNA Splicing - Major Pathway
Estrogen-dependent gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 35751199
Breast Neoplasms Associate 20663877, 22086602, 24626184, 33634895
Carcinogenesis Associate 28443473, 36996491
Carcinogenesis Inhibit 30281815
Carcinoma Basal Cell Associate 31870221
Carcinoma Hepatocellular Associate 30281815, 33042264, 34021034, 38036507
Carcinoma Squamous Cell Associate 26867589
Carcinoma Squamous Cell Stimulate 28443473
CD59 Deficiency Associate 33819916
Colorectal Neoplasms Associate 23349811, 24308539, 34320120