Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1643
Gene name Gene Name - the full gene name approved by the HGNC.	Damage specific DNA binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DDB2
Synonyms (NCBI Gene) Gene synonyms aliases	DDBB, UV-DDB2, XPE
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquityla

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434639	A>G	Pathogenic	Coding sequence variant, intron variant, missense variant
rs121434640	G>A	Pathogenic	Coding sequence variant, intron variant, missense variant
rs121434641	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant, intron variant
rs121434642	G>T	Pathogenic	Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs1336484333	AAAG>-	Likely-pathogenic	Stop gained, coding sequence variant, intron variant

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020865	hsa-miR-155-5p	Proteomics	18668040
MIRT029978	hsa-miR-26b-5p	Microarray	19088304
MIRT756022	hsa-miR-125a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36636074
MIRT756025	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36636074
MIRT928800	hsa-miR-3187-3p	CLIP-seq
MIRT928801	hsa-miR-4264	CLIP-seq
MIRT928802	hsa-miR-4435	CLIP-seq
MIRT928803	hsa-miR-4529-5p	CLIP-seq
MIRT928804	hsa-miR-4701-5p	CLIP-seq
MIRT928805	hsa-miR-4798-5p	CLIP-seq
MIRT928806	hsa-miR-548s	CLIP-seq
MIRT928807	hsa-miR-584	CLIP-seq
MIRT928808	hsa-miR-588	CLIP-seq
MIRT1975060	hsa-miR-3065-3p	CLIP-seq
MIRT1975061	hsa-miR-4726-3p	CLIP-seq
MIRT2514460	hsa-miR-128	CLIP-seq
MIRT2514461	hsa-miR-188-3p	CLIP-seq
MIRT2514462	hsa-miR-198	CLIP-seq
MIRT1975060	hsa-miR-3065-3p	CLIP-seq
MIRT2514463	hsa-miR-3143	CLIP-seq
MIRT2514464	hsa-miR-3150b-3p	CLIP-seq
MIRT2514465	hsa-miR-3184	CLIP-seq
MIRT2514466	hsa-miR-3189-5p	CLIP-seq
MIRT2514467	hsa-miR-326	CLIP-seq
MIRT2514468	hsa-miR-330-5p	CLIP-seq
MIRT2514469	hsa-miR-3609	CLIP-seq
MIRT2514470	hsa-miR-3612	CLIP-seq
MIRT2514471	hsa-miR-3657	CLIP-seq
MIRT2514472	hsa-miR-3663-3p	CLIP-seq
MIRT2514473	hsa-miR-3671	CLIP-seq
MIRT2514474	hsa-miR-371b-3p	CLIP-seq
MIRT2514475	hsa-miR-423-5p	CLIP-seq
MIRT2514476	hsa-miR-4274	CLIP-seq
MIRT2514477	hsa-miR-4443	CLIP-seq
MIRT2514478	hsa-miR-4645-5p	CLIP-seq
MIRT2514479	hsa-miR-4673	CLIP-seq
MIRT2514480	hsa-miR-4719	CLIP-seq
MIRT2514481	hsa-miR-4729	CLIP-seq
MIRT2514482	hsa-miR-4758-3p	CLIP-seq
MIRT2514483	hsa-miR-4784	CLIP-seq
MIRT2514484	hsa-miR-4797-5p	CLIP-seq
MIRT2514485	hsa-miR-4803	CLIP-seq
MIRT2514486	hsa-miR-516b	CLIP-seq
MIRT2514487	hsa-miR-520a-5p	CLIP-seq
MIRT2514488	hsa-miR-525-5p	CLIP-seq
MIRT2514489	hsa-miR-548ah	CLIP-seq
MIRT2514490	hsa-miR-548n	CLIP-seq
MIRT2514491	hsa-miR-548t	CLIP-seq
MIRT2514492	hsa-miR-593	CLIP-seq
MIRT2514493	hsa-miR-650	CLIP-seq
MIRT2514494	hsa-miR-659	CLIP-seq
MIRT2514460	hsa-miR-128	CLIP-seq
MIRT2514461	hsa-miR-188-3p	CLIP-seq
MIRT2514462	hsa-miR-198	CLIP-seq
MIRT2514463	hsa-miR-3143	CLIP-seq
MIRT2514464	hsa-miR-3150b-3p	CLIP-seq
MIRT2514466	hsa-miR-3189-5p	CLIP-seq
MIRT2514467	hsa-miR-326	CLIP-seq
MIRT2514468	hsa-miR-330-5p	CLIP-seq
MIRT2514470	hsa-miR-3612	CLIP-seq
MIRT2514471	hsa-miR-3657	CLIP-seq
MIRT2514474	hsa-miR-371b-3p	CLIP-seq
MIRT2514476	hsa-miR-4274	CLIP-seq
MIRT2514477	hsa-miR-4443	CLIP-seq
MIRT1975061	hsa-miR-4726-3p	CLIP-seq
MIRT2514481	hsa-miR-4729	CLIP-seq
MIRT2514482	hsa-miR-4758-3p	CLIP-seq
MIRT2514483	hsa-miR-4784	CLIP-seq
MIRT2514485	hsa-miR-4803	CLIP-seq
MIRT2514486	hsa-miR-516b	CLIP-seq
MIRT2514487	hsa-miR-520a-5p	CLIP-seq
MIRT2514488	hsa-miR-525-5p	CLIP-seq
MIRT2514490	hsa-miR-548n	CLIP-seq
MIRT2514491	hsa-miR-548t	CLIP-seq
MIRT2514492	hsa-miR-593	CLIP-seq
MIRT2514493	hsa-miR-650	CLIP-seq
MIRT2514494	hsa-miR-659	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
BRCA1	Activation	12170778
NF1	Unknown	12527763
SP1	Unknown	12527763
TP53	Activation	16357511
TP53	Unknown	12771027;12967652;15856024;15927209;22336944
TP63	Unknown	17984111

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	12732143
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000717	Process	Nucleotide-excision repair, DNA duplex unwinding	TAS
GO:0003677	Function	DNA binding	TAS	8798680
GO:0003684	Function	Damaged DNA binding	IBA	21873635
GO:0003684	Function	Damaged DNA binding	IDA	22334663
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	12732143
GO:0005515	Function	Protein binding	IPI	9418871, 12732143, 16473935, 16949367, 17041588, 17360488, 19109893, 19966799, 21145461, 22039351, 22822215, 26496610, 28514442, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IBA	21873635
GO:0006289	Process	Nucleotide-excision repair	TAS	8407967
GO:0006290	Process	Pyrimidine dimer repair	IEA
GO:0006293	Process	Nucleotide-excision repair, preincision complex stabilization	TAS
GO:0006294	Process	Nucleotide-excision repair, preincision complex assembly	TAS
GO:0006295	Process	Nucleotide-excision repair, DNA incision, 3'-to lesion	TAS
GO:0006296	Process	Nucleotide-excision repair, DNA incision, 5'-to lesion	TAS
GO:0009411	Process	Response to UV	IBA	21873635
GO:0009411	Process	Response to UV	IDA	12732143
GO:0016579	Process	Protein deubiquitination	TAS
GO:0030054	Component	Cell junction	IDA
GO:0031465	Component	Cul4B-RING E3 ubiquitin ligase complex	IDA	22334663
GO:0032991	Component	Protein-containing complex	IDA	12732143
GO:0033683	Process	Nucleotide-excision repair, DNA incision	TAS
GO:0035518	Process	Histone H2A monoubiquitination	IDA	22334663
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044877	Function	Protein-containing complex binding	IPI	11564863
GO:0051865	Process	Protein autoubiquitination	IDA	12732143
GO:0070911	Process	Global genome nucleotide-excision repair	TAS
GO:0070914	Process	UV-damage excision repair	IDA	22334663
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IMP	16949367

MIM	HGNC	e!Ensembl
600811	2718	ENSG00000134574

Protein

UniProt ID

Q92466

Protein name

DNA damage-binding protein 2 (DDB p48 subunit) (DDBb) (Damage-specific DNA-binding protein 2) (UV-damaged DNA-binding protein 2) (UV-DDB 2)

Protein function

Protein, which is both involved in DNA repair and protein ubiquitination, as part of the UV-DDB complex and DCX (DDB1-CUL4-X-box) complexes, respectively (PubMed:10882109, PubMed:11278856, PubMed:11705987, PubMed:12732143, PubMed:15882621, PubMe

PDB

3EI4 , 3I7L , 4E54 , 4E5Z , 6R8Y , 6R8Z , 6R90 , 6R91 , 6R92

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	232 → 271	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed; with highest levels in corneal endothelium and lowest levels in brain. Isoform D1 is highly expressed in brain and heart. Isoform D2, isoform D3 and isoform D4 are weakly expressed. {ECO:0000269|PubMed:14751237}

Sequence

MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK

Sequence length

427

Interactions

View interactions

	KEGG		Reactome
	Nucleotide excision repair p53 signaling pathway Ubiquitin mediated proteolysis Hepatitis B Epstein-Barr virus infection Pathways in cancer Transcriptional misregulation in cancer Colorectal cancer Pancreatic cancer Endometrial cancer Glioma Thyroid cancer Basal cell carcinoma Melanoma Chronic myeloid leukemia Small cell lung cancer Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer		Ub-specific processing proteases DNA Damage Recognition in GG-NER Formation of Incision Complex in GG-NER Dual Incision in GG-NER TP53 Regulates Transcription of DNA Repair Genes Neddylation

Show/Hide Causal Diseases (10)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Basal cell carcinoma, Squamous cell carcinoma, Carcinoma, Basal Cell	rs121912654, rs555607708, rs786202962, rs1564055259
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Developmental regression	Developmental regression	rs1224421127
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Keratitis	Keratitis	rs587776571
Melanoma	melanoma, Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Optic atrophy	Optic Atrophy	rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299 View all (37 more)
Xeroderma pigmentosum	XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP E, Xeroderma pigmentosum	rs794729654, rs794729655, rs752088918, rs121965088, rs794729656, rs794729657, rs754532049, rs1200172747, rs104894132, rs104894133, rs104894134, rs1587755557, rs2127773185, rs2127773120, rs121908562 View all (169 more)	14769931, 10469312, 8798680, 12812979, 15558025, 26884178, 24105368, 21107348, 24753253

Show/Hide Unknown Diseases (5)

Disease term	Disease name	References	Source
Unknown
Mental depression	Major Depressive Disorder	29942085	ClinVar
Xeroderma Pigmentosum	xeroderma pigmentosum group E		GenCC
Schizophrenia	Schizophrenia		GWAS
Hypertension	Hypertension		GWAS
Metabolic Syndrome	Metabolic Syndrome		GWAS

Show/Hide Text Mining Associations (58)

Disease Name	Relationship Type	References
Associations from Text Mining
Acne Vulgaris	Associate	24399259
Acute Radiation Syndrome	Associate	33476246, 35680903, 37676284, 38499035
Adenomatous Polyposis Coli	Associate	24259968
Alzheimer Disease	Associate	26263968
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	34584012
Breast Neoplasms	Associate	18431487, 19339246, 26650177, 33017027
Carcinogenesis	Associate	10469312
Carcinoma Hepatocellular	Associate	32090112
Carcinoma Non Small Cell Lung	Associate	27553023
Carcinoma Renal Cell	Associate	36385010
Carcinoma Squamous Cell	Associate	25491297, 32508265
Cell Transformation Neoplastic	Associate	31664956
Chromosome Aberrations	Associate	24770583
Colorectal Neoplasms	Associate	24259968, 35817785
Colorectal Neoplasms	Stimulate	29568775
COVID 19	Associate	37573316
Death	Stimulate	23407396
Drug Hypersensitivity	Associate	24753253
Drug Related Side Effects and Adverse Reactions	Associate	20013802
Endometrial Neoplasms	Associate	37142958
Facial Neoplasms	Associate	17660462
Gastritis Atrophic	Associate	26760766
Genetic Diseases Inborn	Associate	24753253
Genomic Instability	Associate	35817785
Glioma	Associate	16247447
Hematologic Diseases	Associate	37676284
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16357511, 18431487
Hypoxia	Stimulate	31740787
Hypoxia	Associate	35813480
Infections	Associate	24335308
Inflammation	Associate	24399259
Leukemia Lymphocytic Chronic B Cell	Associate	18945750
Lysosomal Storage Diseases	Associate	17357082
Melanoma	Inhibit	16888633
Melanoma	Associate	17597816, 23407396, 27487145, 37573316
Mesothelioma Malignant	Associate	30700254
Neoplasms	Associate	12170778, 17660462, 18431487, 24770583, 25491297, 26130719
Neoplasms	Inhibit	31740787
Obesity	Associate	29459183
Osteosarcoma	Associate	31337976
Ovarian Diseases	Inhibit	29752431
Ovarian Neoplasms	Associate	20013802, 24249678, 26130719
Ovarian Neoplasms	Inhibit	29752431
Prostatic Neoplasms	Associate	28212551
Skin Neoplasms	Associate	21388382, 24753253, 37573316
Small Cell Lung Carcinoma	Associate	32457468
Smoke Inhalation Injury	Associate	23720401, 26760766
Spinocerebellar Ataxia Autosomal Recessive 2	Associate	17984111
Squamous Cell Carcinoma of Head and Neck	Associate	31740787
Stomach Neoplasms	Inhibit	26760766
Stomach Neoplasms	Associate	26760766, 27340861, 36672781
Supranuclear Palsy Progressive	Associate	17357082
Triple Negative Breast Neoplasms	Associate	31541611
UV Sensitive Syndrome	Associate	32457468
Xeroderma Pigmentosum	Associate	10469312, 10771487, 12732143, 14560002, 21388382, 24335308, 24753253, 24770583, 25491297, 28719581, 30251654
Xeroderma Pigmentosum	Inhibit	16473935
Xeroderma Pigmentosum Complementation Group E	Associate	12170778, 12181326, 12527763, 16527807, 20368362, 22334663, 24760829, 37573316
Xeroderma Pigmentosum Complementation Group E	Inhibit	16473935

DDB2 (damage specific DNA binding protein 2)