Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1627
Gene name Gene Name - the full gene name approved by the HGNC.
Drebrin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DBN1
Synonyms (NCBI Gene) Gene synonyms aliases
D0S117E
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020934 hsa-miR-155-5p Proteomics 18668040
MIRT024053 hsa-miR-1-3p Proteomics 18668040
MIRT024053 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT046733 hsa-miR-222-3p CLASH 23622248
MIRT045543 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0003779 Function Actin binding NAS 12761245
GO:0005515 Function Protein binding IPI 12577067, 20215400, 21044950, 23750010, 23926103, 23940795, 25814554, 25839164, 28966017
GO:0005522 Function Profilin binding ISS
GO:0005737 Component Cytoplasm IDA 8838578, 28966017
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
126660 2695 ENSG00000113758
Protein
UniProt ID Q16643
Protein name Drebrin (Developmentally-regulated brain protein)
Protein function Actin cytoskeleton-organizing protein that plays a role in the formation of cell projections (PubMed:20215400). Required for actin polymerization at immunological synapses (IS) and for the recruitment of the chemokine receptor CXCR4 to IS (PubMe
PDB 5Y1Z , 5ZZ9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00241 Cofilin_ADF 13 132 Cofilin/tropomyosin-type actin-binding protein Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brain, with expression in the molecular layer of the dentate gyrus, stratum pyramidale, and stratum radiatum of the hippocampus (at protein level) (PubMed:8838578). Also expressed in the terminal varicosities distribut
Sequence
MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFEN
QKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASS
VEDIDAGAIGQR
LSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQF
WEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQ
TLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERV
ASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVT
SSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAED
LMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
GNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPP
ATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQ
SQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD
Sequence length 649
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
15140563, 16402129, 23566496
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32015686
Alzheimer Disease Inhibit 22310934
Alzheimer Disease Associate 22760556, 22832605, 28966017
Bipolar Disorder Inhibit 19945534
Bipolar Disorder Associate 22760556, 35821008
Carcinogenesis Associate 16185277
Carcinoma Basal Cell Associate 16185277
Carcinoma Hepatocellular Associate 34092977
Carcinoma Non Small Cell Lung Associate 21242119
Cognition Disorders Associate 28966017