SPPL2C (signal peptide peptidase like 2C)

Gene

• Entrez ID: 162540
• Gene name: Signal peptide peptidase like 2C
• Gene symbol: SPPL2C
• Synonyms (NCBI Gene): IMP5
• Chromosome: 17
• Chromosome location: 17q21.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017486	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001675	Process	Acrosome assembly	IEA
GO:0001675	Process	Acrosome assembly	ISS
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	16829952
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IMP	17965014
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030660	Component	Golgi-associated vesicle membrane	IBA
GO:0031293	Process	Membrane protein intracellular domain proteolysis	IMP	16829952
GO:0033619	Process	Membrane protein proteolysis	IBA
GO:0035036	Process	Sperm-egg recognition	ISS
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	IBA
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	IEA
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	15385547
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IBA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IDA	15385547
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IEA
GO:0098554	Component	Cytoplasmic side of endoplasmic reticulum membrane	IBA
GO:0098554	Component	Cytoplasmic side of endoplasmic reticulum membrane	IDA	15385547
GO:0098554	Component	Cytoplasmic side of endoplasmic reticulum membrane	IEA

Other IDs

• MIM: 608284
• HGNC: 28902
• e!Ensembl: ENSG00000185294

Protein

• UniProt ID: Q8IUH8
• Protein name: Signal peptide peptidase-like 2C (SPP-like 2C) (SPPL2c) (EC 3.4.23.-) (Intramembrane protease 5) (IMP-5)
• Protein function: Sperm-specific intramembrane-cleaving aspartic protease (I-CLiP) that cleaves distinct tail-anchored proteins and SNARE proteins (PubMed:30733281). In elongated spermatids, modulates intracellular Ca(2+) homeostasis by controlling PLN abundance
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04258	Peptidase_A22B	241 → 532	Signal peptide peptidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis where it is primarily localised in spermatids (at protein level). {ECO:0000269|PubMed:30733281}.
• Sequence:

  MACLGFLLPVGFLLLISTVAGGKYGVAHVVSENWSKDYCILFSSDYITLPRDLHHAPLLP
  LYDGTKAPWCPGEDSPHQAQLRSPSQRPLRQTTAMVMRGNCSFHTKGWLAQGQGAHGLLI
  VSRVSDQQCSDTTLAPQDPRQPLADLTIPVAMLHYADMLDILSHTRGEAVVRVAMYAPPE
  PIIDYNMLVIFILAVGTVAAGGYWAGLTEANRLQRRRARRGGGSGGHHQLQEAAAAEGAQ
  KEDNEDIPVDFTPAMTGVVVTLSCSLMLLLYFFYDHFVYVTIGIFGLGAGIGLYSCLSPL
  VCRLSLRQYQRPPHSLWASLPLPLLLLASLCATVIIFWVAYRNEDRWAWLLQDTLGISYC
  LFVLHRVRLPTLKNCSSFLLALLAFDVFFVFVTPFFTKTGESIMAQVALGPAESSSHERL
  PMVLKVPRLRVSALTLCSQPFSILGFGDIVVPGFLVAYCCRFDVQVCSRQIYFVACTVAY
  AVGLLVTFMAMVLMQMGQPALLYLVSSTLLTSLAVAACRQELSLFWTGQGRAKMCGLGCA
  PSAGSRQKQEGAADAHTASTLERGTSRGAGDLDSNPGEDTTEIVTISENEATNPEDRSDS
  SEGWSDAHLDPNELPFIPPGASEELMPLMPMAMLIPLMPLMPPPSELGHVHAQAQAHETG
  LPWAGLHKRKGLKVRKSMSTQAPL

• Sequence length: 684