Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1622
Gene name Gene Name - the full gene name approved by the HGNC.	Diazepam binding inhibitor, acyl-CoA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DBI
Synonyms (NCBI Gene) Gene synonyms aliases	ACBD1, ACBP, CCK-RP, EP
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid rec

Show/Hide all(137)

miRTarBase ID	miRNA	Experiments
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923718	hsa-miR-3942-3p	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923723	hsa-miR-495	CLIP-seq
MIRT923724	hsa-miR-548a-5p	CLIP-seq
MIRT923725	hsa-miR-548ab	CLIP-seq
MIRT923726	hsa-miR-548ac	CLIP-seq
MIRT923727	hsa-miR-548ae	CLIP-seq
MIRT923728	hsa-miR-548aj	CLIP-seq
MIRT923729	hsa-miR-548ak	CLIP-seq
MIRT923730	hsa-miR-548am	CLIP-seq
MIRT923731	hsa-miR-548b-5p	CLIP-seq
MIRT923732	hsa-miR-548c-5p	CLIP-seq
MIRT923733	hsa-miR-548d-3p	CLIP-seq
MIRT923734	hsa-miR-548d-5p	CLIP-seq
MIRT923735	hsa-miR-548h	CLIP-seq
MIRT923736	hsa-miR-548i	CLIP-seq
MIRT923737	hsa-miR-548j	CLIP-seq
MIRT923738	hsa-miR-548k	CLIP-seq
MIRT923739	hsa-miR-548l	CLIP-seq
MIRT923740	hsa-miR-548w	CLIP-seq
MIRT923741	hsa-miR-548x	CLIP-seq
MIRT923742	hsa-miR-548y	CLIP-seq
MIRT923743	hsa-miR-548z	CLIP-seq
MIRT923744	hsa-miR-559	CLIP-seq
MIRT923745	hsa-miR-577	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923747	hsa-miR-606	CLIP-seq
MIRT923748	hsa-miR-802	CLIP-seq
MIRT923749	hsa-miR-888	CLIP-seq
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923750	hsa-miR-1256	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923751	hsa-miR-183	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923752	hsa-miR-3910	CLIP-seq
MIRT923718	hsa-miR-3942-3p	CLIP-seq
MIRT923753	hsa-miR-3943	CLIP-seq
MIRT923754	hsa-miR-4323	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923755	hsa-miR-4643	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923756	hsa-miR-4717-3p	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923723	hsa-miR-495	CLIP-seq
MIRT923724	hsa-miR-548a-5p	CLIP-seq
MIRT923725	hsa-miR-548ab	CLIP-seq
MIRT923726	hsa-miR-548ac	CLIP-seq
MIRT923727	hsa-miR-548ae	CLIP-seq
MIRT923728	hsa-miR-548aj	CLIP-seq
MIRT923729	hsa-miR-548ak	CLIP-seq
MIRT923730	hsa-miR-548am	CLIP-seq
MIRT923731	hsa-miR-548b-5p	CLIP-seq
MIRT923732	hsa-miR-548c-5p	CLIP-seq
MIRT923733	hsa-miR-548d-3p	CLIP-seq
MIRT923734	hsa-miR-548d-5p	CLIP-seq
MIRT923735	hsa-miR-548h	CLIP-seq
MIRT923736	hsa-miR-548i	CLIP-seq
MIRT923737	hsa-miR-548j	CLIP-seq
MIRT923738	hsa-miR-548k	CLIP-seq
MIRT923739	hsa-miR-548l	CLIP-seq
MIRT923740	hsa-miR-548w	CLIP-seq
MIRT923741	hsa-miR-548x	CLIP-seq
MIRT923742	hsa-miR-548y	CLIP-seq
MIRT923743	hsa-miR-548z	CLIP-seq
MIRT923744	hsa-miR-559	CLIP-seq
MIRT923745	hsa-miR-577	CLIP-seq
MIRT923747	hsa-miR-606	CLIP-seq
MIRT923757	hsa-miR-651	CLIP-seq
MIRT923748	hsa-miR-802	CLIP-seq
MIRT923749	hsa-miR-888	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923750	hsa-miR-1256	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923752	hsa-miR-3910	CLIP-seq
MIRT1973635	hsa-miR-4264	CLIP-seq
MIRT1973636	hsa-miR-4328	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT1973637	hsa-miR-4797-3p	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923757	hsa-miR-651	CLIP-seq
MIRT923711	hsa-miR-1224-3p	CLIP-seq
MIRT923750	hsa-miR-1256	CLIP-seq
MIRT923712	hsa-miR-1260	CLIP-seq
MIRT923713	hsa-miR-1260b	CLIP-seq
MIRT923714	hsa-miR-1280	CLIP-seq
MIRT923751	hsa-miR-183	CLIP-seq
MIRT923715	hsa-miR-188-3p	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923717	hsa-miR-3156-3p	CLIP-seq
MIRT923752	hsa-miR-3910	CLIP-seq
MIRT1973635	hsa-miR-4264	CLIP-seq
MIRT1973636	hsa-miR-4328	CLIP-seq
MIRT923719	hsa-miR-4446-5p	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923755	hsa-miR-4643	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923756	hsa-miR-4717-3p	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT1973637	hsa-miR-4797-3p	CLIP-seq
MIRT923746	hsa-miR-582-3p	CLIP-seq
MIRT923757	hsa-miR-651	CLIP-seq
MIRT923716	hsa-miR-299-5p	CLIP-seq
MIRT923753	hsa-miR-3943	CLIP-seq
MIRT923754	hsa-miR-4323	CLIP-seq
MIRT923720	hsa-miR-4468	CLIP-seq
MIRT923721	hsa-miR-4710	CLIP-seq
MIRT923722	hsa-miR-4792	CLIP-seq
MIRT923727	hsa-miR-548ae	CLIP-seq
MIRT923728	hsa-miR-548aj	CLIP-seq
MIRT923730	hsa-miR-548am	CLIP-seq
MIRT923741	hsa-miR-548x	CLIP-seq
MIRT923747	hsa-miR-606	CLIP-seq
MIRT923749	hsa-miR-888	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PPARG	Unknown	12015306

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006637	Process	Acyl-CoA metabolic process	TAS
GO:0008289	Function	Lipid binding	IEA
GO:0030156	Function	Benzodiazepine receptor binding	TAS	3020548
GO:0032994	Component	Protein-lipid complex	IDA	21079819
GO:0036042	Function	Long-chain fatty acyl-CoA binding	IDA	21079819
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IDA	21079819
GO:0042802	Function	Identical protein binding	IPI	21079819
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:1903060	Process	Negative regulation of protein lipidation	IDA	21079819
GO:1905920	Process	Positive regulation of CoA-transferase activity	IDA	21079819
GO:2001140	Process	Positive regulation of phospholipid transport	IDA	21079819

MIM	HGNC	e!Ensembl
125950	2690	ENSG00000155368

Protein

UniProt ID

P07108

Protein name

Acyl-CoA-binding protein (ACBP) (Diazepam-binding inhibitor) (DBI) (Endozepine) (EP)

Protein function

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A

PDB

2CB8 , 2FJ9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00887	ACBP	3 → 83	Acyl CoA binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. {ECO:0000269|PubMed:16055366, E

Sequence

MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWN
ELKGTSKEDAMKAYINKVEELKKKYGI

Sequence length

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway		Mitochondrial Fatty Acid Beta-Oxidation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	12376462

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Dementia	Dementia			GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Autism Spectrum Disorder	Associate	30921354
Carcinoma Non Small Cell Lung	Associate	24819876
Cholangiocarcinoma	Associate	34320944
Fatigue	Associate	24054763
Fatigue Syndrome Chronic	Associate	24054763
Glioblastoma	Associate	37120445
Language Disorders	Associate	30921354
Lipoid congenital adrenal hyperplasia	Associate	1661294
Lung Neoplasms	Stimulate	24819876
Neoplasms	Associate	19815704, 35748856

DBI (diazepam binding inhibitor, acyl-CoA binding protein)