BRINP1 (BMP/retinoic acid inducible neural specific 1)

Gene

• Entrez ID: 1620
• Gene name: BMP/retinoic acid inducible neural specific 1
• Gene symbol: BRINP1
• Synonyms (NCBI Gene): DBC1, DBCCR1, FAM5A
• Chromosome: 9
• Chromosome location: 9q33.1
• Summary: This gene is located within a chromosomal region that shows loss of heterozygosity in some bladder cancers. It contains a 5` CpG island that may be a frequent target of hypermethylation, and it may undergo hypermethylation-based silencing in some bladder

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001662	Process	Behavioral fear response	IEA
GO:0005515	Function	Protein binding	IPI	12442002, 22446626
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11420708
GO:0005737	Component	Cytoplasm	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007420	Process	Brain development	IEA
GO:0007614	Process	Short-term memory	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010498	Process	Proteasomal protein catabolic process	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IBA
GO:0021954	Process	Central nervous system neuron development	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0030425	Component	Dendrite	IBA
GO:0035176	Process	Social behavior	IEA
GO:0035640	Process	Exploration behavior	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0045202	Component	Synapse	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IBA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0071300	Process	Cellular response to retinoic acid	IBA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071625	Process	Vocalization behavior	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 602865
• HGNC: 2687
• e!Ensembl: ENSG00000078725

Protein

• UniProt ID: O60477
• Protein name: BMP/retinoic acid-inducible neural-specific protein 1 (Deleted in bladder cancer protein 1)
• Protein function: Plays a role in neurogenesis and brain development (By similarity). May suppress cell cycle progression in postmitotic neurons by inhibiting G1/S transition (PubMed:11420708).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01823	MACPF	47 → 202	MAC/Perforin domain	Domain
  PF19052	BRINP	306 → 761	BMP/retinoic acid-inducible neural-specific protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain. Weakly expressed in heart, lung, skeletal muscle, kidney, thymus, prostate, testis and small intestine. {ECO:0000269|PubMed:9545632}.
• Sequence:

  MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVER
  HRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDT
  IIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMR
  RLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQE
  KFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEA
  YKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSATEAQRQKIQRTA
  RKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTT
  LCQRPIPCVIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETD
  LDFQDLELKYLLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHM
  VIGMSMRICQMRNSSLDPMFFVYVNPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNW
  TLLLGNRWKTFFETVHIYLRSRTRLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGY
  SLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLF
  SCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC

• Sequence length: 761