GPR180 (G protein-coupled receptor 180)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
160897
Gene name Gene Name - the full gene name approved by the HGNC.
G protein-coupled receptor 180
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPR180
Synonyms (NCBI Gene) Gene synonyms aliases
ITR
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling. [provided by RefSeq
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(585)
miRTarBase ID miRNA Experiments Reference
MIRT024681 hsa-miR-215-5p Microarray 19074876
MIRT026775 hsa-miR-192-5p Microarray 19074876
MIRT027173 hsa-miR-103a-3p Sequencing 20371350
MIRT031916 hsa-miR-16-5p Sequencing 20371350
MIRT668067 hsa-miR-627-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0006091 Process Generation of precursor metabolites and energy IEA
GO:0006629 Process Lipid metabolic process IEA
GO:0007186 Process G protein-coupled receptor signaling pathway IEA
GO:0010467 Process Gene expression IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607787 28899 ENSG00000152749
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q86V85
Protein name Integral membrane protein GPR180 (Intimal thickness-related receptor)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10192 GpcrRhopsn4 141 → 405 Rhodopsin-like GPCR transmembrane domain Family
Sequence 
MGGLRLLAVALTCCWWPQGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINN
IAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQ
TWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGESGLHEFFFLLVLV
YFVIACIYAQSLWQAIKKGGPMHMILKVLTTALLLQAGSALANYIHFSSYSKDGIGVPFM
GSLAEFFDIASQIQMLYLLLSLCMGWTIVRMKKSQSRPLQWDSTPASTGIAVFIVMTQSV
LLLWEQFEDISHHSYHSHHNLAGILLIVLRICLALSLGCGLYQIITVERSTLKREFYITF
AKGCILWFLCHPVLACISVIFSDYQRDKVITIGVILCQSVSMVILYRLFLSHSLYWEVSS
LSSVTLPLTISSGHKSRPHF
Sequence length 440
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Hepatoblastoma Associate 26991471
Hypertriglyceridemia Associate 31868224
Microcoria congenital Associate 32200002
Neoplasms Inhibit 26991471
Vascular Remodeling Associate 23940718