CYP2D7 (cytochrome P450 family 2 subfamily D member 7 (gene/pseudogene))

Gene

• Entrez ID: 1564
• Gene name: Cytochrome P450 family 2 subfamily D member 7 (gene/pseudogene)
• Gene symbol: CYP2D7
• Synonyms (NCBI Gene): CYP2D, CYP2D6, CYP2D7AP, CYP2D7P, CYP2D7P1, CYP2D@, P450C2D, P450DB1, RNA40057
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: This gene is a member of the cytochrome P450 gene superfamily. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is a segregating ps

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	15051713
GO:0005739	Component	Mitochondrion	IDA	18838503
GO:0006082	Process	Organic acid metabolic process	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	IDA	15051713
GO:0006805	Process	Xenobiotic metabolic process	IDA	18838503
GO:0008395	Function	Steroid hydroxylase activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA	21873635
GO:0019369	Process	Arachidonic acid metabolic process	IBA	21873635
GO:0020037	Function	Heme binding	IBA	21873635
GO:0042738	Process	Exogenous drug catabolic process	IBA	21873635
GO:0042738	Process	Exogenous drug catabolic process	IDA	15051713
GO:0042738	Process	Exogenous drug catabolic process	IDA	18838503
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0070330	Function	Aromatase activity	IDA	15051713
GO:0070330	Function	Aromatase activity	IDA	18838503

Other IDs

• MIM: HGNC
• HGNC: 2624
• e!Ensembl: N/A

Protein

• UniProt ID: A0A087X1C5
• Protein name: Cytochrome P450 2D7 (EC 1.14.14.1)
• Protein function: May be responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It may be involved in the metabolism of codeine to morphine (PubMed:15051713). However, another study could not confirm it (PubMed:18838503). {ECO:
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	34 → 332	Cytochrome P450	Domain
  PF00067	p450	345 → 512	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain cortex (at protein level). {ECO:0000269|PubMed:15051713}.
• Sequence:

  MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
  LRRRFGDVFSLQLAWTPVVVLNGLAAVREAMVTRGEDTADRPPAPIYQVLGFGPRSQGVI
  LSRYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFADQAGRPFRPNGLLDK
  AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLPHIPALAGKV
  LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKEKAKGSPESSFNDENLRIVVG
  NLFLAGMVTTSTTLAWGLLLMILHLDVQRGRRVSPGCPIVGTHVCPVRVQQEIDDVIGQV
  RRPEMGDQAHMPCTTAVIHEVQHFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSV
  LKDEAVWKKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQ
  HFSFSVAAGQPRPSHSRVVSFLVTPSPYELCAVPR

• Sequence length: 515

Pathways

KEGG:

Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Endocrine resistance
Serotonergic synapse

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	28540026, 31374203

Associations from Text Mining
Disease Name	Relationship Type	References
Death	Associate	31609742
Diabetes Gestational	Associate	35721735
Liver Failure Acute	Associate	31609742