CYP2D7 (cytochrome P450 family 2 subfamily D member 7 (gene/pseudogene))

Gene

• Entrez ID: 1564
• Gene name: Cytochrome P450 family 2 subfamily D member 7 (gene/pseudogene)
• Gene symbol: CYP2D7
• Synonyms (NCBI Gene): CYP2D, CYP2D6, CYP2D7AP, CYP2D7P, CYP2D7P1, CYP2D@, P450C2D, P450DB1, RNA40057
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: This gene is a member of the cytochrome P450 gene superfamily. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is a segregating ps

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15051713
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	18838503
GO:0005739	Component	Mitochondrion	IEA
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	IDA	18838503
GO:0006805	Process	Xenobiotic metabolic process	IDA	15051713
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IBA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0020037	Function	Heme binding	IBA
GO:0020037	Function	Heme binding	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	18838503
GO:0042178	Process	Xenobiotic catabolic process	IDA	15051713
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070330	Function	Aromatase activity	IDA	18838503
GO:0070330	Function	Aromatase activity	IDA	15051713

Other IDs

• MIM: HGNC
• HGNC: 2624
• e!Ensembl: N/A

Protein

• UniProt ID: A0A087X1C5
• Protein name: Cytochrome P450 2D7 (EC 1.14.14.1)
• Protein function: May be responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It may be involved in the metabolism of codeine to morphine (PubMed:15051713). However, another study could not confirm it (PubMed:18838503). {ECO:
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	34 → 332	Cytochrome P450	Domain
  PF00067	p450	345 → 512	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain cortex (at protein level). {ECO:0000269|PubMed:15051713}.
• Sequence:

  MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
  LRRRFGDVFSLQLAWTPVVVLNGLAAVREAMVTRGEDTADRPPAPIYQVLGFGPRSQGVI
  LSRYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFADQAGRPFRPNGLLDK
  AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLPHIPALAGKV
  LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAKKEKAKGSPESSFNDENLRIVVG
  NLFLAGMVTTSTTLAWGLLLMILHLDVQRGRRVSPGCPIVGTHVCPVRVQQEIDDVIGQV
  RRPEMGDQAHMPCTTAVIHEVQHFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSV
  LKDEAVWKKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQ
  HFSFSVAAGQPRPSHSRVVSFLVTPSPYELCAVPR

• Sequence length: 515

Pathways

KEGG:

Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Endocrine resistance
Serotonergic synapse