SH3RF2 (SH3 domain containing ring finger 2)

Gene

• Entrez ID: 153769
• Gene name: SH3 domain containing ring finger 2
• Gene symbol: SH3RF2
• Synonyms (NCBI Gene): HEPP1, POSHER, PPP1R39, RNF158
• Chromosome: 5
• Chromosome location: 5q32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT539746	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT539745	hsa-miR-433-5p	PAR-CLIP	21572407
MIRT539744	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT539743	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT539741	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT539742	hsa-miR-769-5p	PAR-CLIP	21572407
MIRT539740	hsa-miR-4684-5p	PAR-CLIP	21572407
MIRT539746	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT539745	hsa-miR-433-5p	PAR-CLIP	21572407
MIRT539744	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT539743	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT539741	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT539742	hsa-miR-769-5p	PAR-CLIP	21572407
MIRT539740	hsa-miR-4684-5p	PAR-CLIP	21572407
MIRT1345637	hsa-miR-3189-3p	CLIP-seq
MIRT1345638	hsa-miR-483-3p	CLIP-seq
MIRT1345639	hsa-miR-5096	CLIP-seq
MIRT2326785	hsa-miR-1343	CLIP-seq
MIRT2326786	hsa-miR-3074-5p	CLIP-seq
MIRT2326787	hsa-miR-3124-3p	CLIP-seq
MIRT2326788	hsa-miR-3160-5p	CLIP-seq
MIRT2326789	hsa-miR-3689d	CLIP-seq
MIRT2326790	hsa-miR-3690	CLIP-seq
MIRT2326791	hsa-miR-4254	CLIP-seq
MIRT2394401	hsa-miR-183	CLIP-seq
MIRT2394402	hsa-miR-3677-5p	CLIP-seq
MIRT2394403	hsa-miR-3923	CLIP-seq
MIRT2394404	hsa-miR-4435	CLIP-seq
MIRT2394405	hsa-miR-885-3p	CLIP-seq
MIRT2690677	hsa-miR-297	CLIP-seq
MIRT2690678	hsa-miR-3149	CLIP-seq
MIRT2690679	hsa-miR-3202	CLIP-seq
MIRT2690680	hsa-miR-4307	CLIP-seq
MIRT2690681	hsa-miR-4528	CLIP-seq
MIRT2690682	hsa-miR-4533	CLIP-seq
MIRT2690683	hsa-miR-567	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	19389623, 19945436, 22321011, 24130170, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	24130170
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0008157	Function	Protein phosphatase 1 binding	IBA
GO:0008157	Function	Protein phosphatase 1 binding	IDA	19945436
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019902	Function	Phosphatase binding	IDA	19389623
GO:0030335	Process	Positive regulation of cell migration	IMP	24130170
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	24130170
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	22128169
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	24130170
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0046328	Process	Regulation of JNK cascade	IEA
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0046329	Process	Negative regulation of JNK cascade	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	24130170
GO:0046872	Function	Metal ion binding	IEA
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	IMP	24130170
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	24130170

Other IDs

• MIM: 613377
• HGNC: 26299
• e!Ensembl: ENSG00000156463

Protein

• UniProt ID: Q8TEC5
• Protein name: E3 ubiquitin-protein ligase SH3RF2 (EC 2.3.2.27) (Heart protein phosphatase 1-binding protein) (HEPP1) (POSH-eliminating RING protein) (Protein phosphatase 1 regulatory subunit 39) (RING finger protein 158) (RING-type E3 ubiquitin transferase SH3RF2) (SH3
• Protein function: Has E3 ubiquitin-protein ligase activity (PubMed:24130170). Acts as an anti-apoptotic regulator of the JNK pathway by ubiquitinating and promoting the degradation of SH3RF1, a scaffold protein that is required for pro-apoptotic JNK activation (P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13445	zf-RING_UBOX	12 → 50	RING-type zinc-finger	Domain
  PF07653	SH3_2	129 → 182	Variant SH3 domain	Domain
  PF00018	SH3_1	193 → 244	SH3 domain	Domain
  PF14604	SH3_9	387 → 437	Variant SH3 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Heart (at protein level). Up-regulated in colon cancer tissues as compared to normal colon tissues (at protein level). Testis. In the heart, present in the apex, left atrium, right atrium, left ventricle and right ventricle, but not in
• Sequence:

  MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRVFKAHKELRCPECRTPVFSNI
  EALPANLLLVRLLDGVRSGQSSGRGGSFRRPGTMTLQDGRKSRTNPRRLQASPFRLVPNV
  RIHMDGVPRAKALCNYRGQNPGDLRFNKGDIILLRRQLDENWYQGEINGISGNFPASSVE
  VIKQLPQPPPLCRALYNFDLRGKDKSENQDCLTFLKDDIITVISRVDENWAEGKLGDKVG
  IFPILFVEPNLTARHLLEKNKGRQSSRTKNLSLVSSSSRGNTSTLRRGPGSRRKVPGQFS
  ITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVITQPMEKADVPSSCVGQVSTYHPA
  PVSPGHSTAVVSLPGSQQHLSANMFVALHSYSAHGPDELDLQKGEGVRVLGKCQDGWLRG
  VSLVTGRVGIFPNNYVIPIFRKTSSFPDSRSPGLYTTWTLSTSSVSSQGSISEGDPRQSR
  PFKSVFVPTAIVNPVRSTAGPGTLGQGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRR
  SPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSEAWIHSAASSL
  IMEDKEIPIKSEPLPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHYTSHP
  TSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALGKATTLVSTAS
  GTQTVFPSK

• Sequence length: 729