Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
153443
Gene name Gene Name - the full gene name approved by the HGNC.
Serum response factor binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SRFBP1
Synonyms (NCBI Gene) Gene synonyms aliases
BUD22, P49, Rlb1, STRAP, p49/STRAP
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q23.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT626189 hsa-miR-4714-5p HITS-CLIP 23824327
MIRT626188 hsa-miR-514a-5p HITS-CLIP 23824327
MIRT626187 hsa-miR-3664-5p HITS-CLIP 23824327
MIRT626186 hsa-miR-1-5p HITS-CLIP 23824327
MIRT626185 hsa-miR-4524a-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005634 Component Nucleus IBA 21873635
GO:0030490 Process Maturation of SSU-rRNA IBA 21873635
GO:0030686 Component 90S preribosome IBA 21873635
GO:0048471 Component Perinuclear region of cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610479 26333 ENSG00000151304
Protein
UniProt ID Q8NEF9
Protein name Serum response factor-binding protein 1 (SRF-dependent transcription regulation-associated protein) (p49/STRAP)
Protein function May be involved in regulating transcriptional activation of cardiac genes during the aging process. May play a role in biosynthesis and/or processing of SLC2A4 in adipose cells (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09073 BUD22 350 428 BUD22 Family
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in heart and skeletal muscle, and at much lower levels in brain and lung. {ECO:0000269|PubMed:15492011}.
Sequence
MAQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLKNQRRAQRLLE
EIHAMKELKPDIVTKSALGDDINFEKIFKKPDSTATERAIARLAVHPLLKKKIDVLKAAV
QAFKEARQNVAEVESSKNASEDNHSENTLYSNDNGSNLQREATVISEQKVKETKILAKKP
IHNSKEKIAKMEHGPKAVTIANSPSKPSEKDSVVSLESQKTPADPKLKTLSQTKKNKGSD
SSLSGNSDGGEEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC
HSSVKEQKPLEKVFLKEDTGETHGDTRNDKIKPSTETRKLESVFFHSLSGSKSSRRNFKE
QAPKTRSLDFPQNEPQIKNQFNKKLSGRLENTKQQLQLPLHPSWEASRRRKEQQSNIAVF
QGKKITFD
D
Sequence length 429
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Aortic aneurysm AORTIC ANEURYSM, FAMILIAL THORACIC 10 rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953
View all (29 more)
Congenital aneurysm of ascending aorta Congenital aneurysm of ascending aorta rs1553508473
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 29212778
Thoracic aortic aneurysm and aortic dissection Familial thoracic aortic aneurysm and aortic dissection rs121964962, rs121964964, rs5742905, rs121964969, rs28934891, rs375846341, rs121964972, rs121964973, rs587776600, rs121908172, rs121908173, rs121918714, rs104893809, rs104893815, rs104893810
View all (614 more)
26838787, 27432961
Unknown
Disease term Disease name Evidence References Source
Myocardial Infarction Myocardial Infarction GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 26212323
Glaucoma Associate 36833422
Glaucoma Angle Closure Associate 36833422
Glaucoma Open Angle Associate 36833422
Hepatitis C Associate 26212323