Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	153090
Gene name	DAB2 interacting protein
Gene symbol	DAB2IP
Synonyms (NCBI Gene)	AF9Q34AIP-1AIP1DIP1/2
Chromosome	9
Chromosome location	9q33.2
Summary	DAB2IP is a Ras (MIM 190020) GTPase-activating protein (GAP) that acts as a tumor suppressor. The DAB2IP gene is inactivated by methylation in prostate and breast cancers (Yano et al., 2005 [PubMed 15386433]).[supplied by OMIM, May 2010]

269

Show/Hide all (269)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT003041	hsa-miR-338-3p	qRT-PCRWestern blot	18684991
MIRT052296	hsa-let-7b-5p	CLASH	23622248
MIRT040771	hsa-miR-18a-3p	CLASH	23622248
MIRT173869	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT173873	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT173868	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT173873	hsa-miR-92b-3p	Luciferase reporter assayqRT-PCRWestern blot	27430302
MIRT173873	hsa-miR-92b-3p	Luciferase reporter assayqRT-PCRWestern blot	27430302
MIRT734081	hsa-miR-431-5p	Luciferase reporter assayWestern blotting	31953039
MIRT737438	hsa-miR-328-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	31776329
MIRT922551	hsa-miR-1205	CLIP-seq
MIRT922552	hsa-miR-1207-5p	CLIP-seq
MIRT922553	hsa-miR-1238	CLIP-seq
MIRT922554	hsa-miR-1827	CLIP-seq
MIRT922555	hsa-miR-1976	CLIP-seq
MIRT922556	hsa-miR-200b	CLIP-seq
MIRT922557	hsa-miR-200c	CLIP-seq
MIRT922558	hsa-miR-2278	CLIP-seq
MIRT922559	hsa-miR-25	CLIP-seq
MIRT922560	hsa-miR-302f	CLIP-seq
MIRT922561	hsa-miR-3064-5p	CLIP-seq
MIRT922562	hsa-miR-3189-3p	CLIP-seq
MIRT922563	hsa-miR-32	CLIP-seq
MIRT922564	hsa-miR-323b-3p	CLIP-seq
MIRT922565	hsa-miR-3591-3p	CLIP-seq
MIRT922566	hsa-miR-3611	CLIP-seq
MIRT922567	hsa-miR-3622a-3p	CLIP-seq
MIRT922568	hsa-miR-3622b-3p	CLIP-seq
MIRT922569	hsa-miR-363	CLIP-seq
MIRT922570	hsa-miR-3659	CLIP-seq
MIRT922571	hsa-miR-3665	CLIP-seq
MIRT922572	hsa-miR-367	CLIP-seq
MIRT922573	hsa-miR-3689a-3p	CLIP-seq
MIRT922574	hsa-miR-3689c	CLIP-seq
MIRT922575	hsa-miR-3690	CLIP-seq
MIRT922576	hsa-miR-3918	CLIP-seq
MIRT922577	hsa-miR-4252	CLIP-seq
MIRT922578	hsa-miR-4263	CLIP-seq
MIRT922579	hsa-miR-4267	CLIP-seq
MIRT922580	hsa-miR-429	CLIP-seq
MIRT922581	hsa-miR-4292	CLIP-seq
MIRT922582	hsa-miR-4308	CLIP-seq
MIRT922583	hsa-miR-4311	CLIP-seq
MIRT922584	hsa-miR-4446-5p	CLIP-seq
MIRT922585	hsa-miR-4471	CLIP-seq
MIRT922586	hsa-miR-4514	CLIP-seq
MIRT922587	hsa-miR-4520a-3p	CLIP-seq
MIRT922588	hsa-miR-4532	CLIP-seq
MIRT922589	hsa-miR-4638-3p	CLIP-seq
MIRT922590	hsa-miR-4658	CLIP-seq
MIRT922591	hsa-miR-4677-3p	CLIP-seq
MIRT922592	hsa-miR-4679	CLIP-seq
MIRT922593	hsa-miR-4687-3p	CLIP-seq
MIRT922594	hsa-miR-4691-3p	CLIP-seq
MIRT922595	hsa-miR-4691-5p	CLIP-seq
MIRT922596	hsa-miR-4692	CLIP-seq
MIRT922597	hsa-miR-4709-3p	CLIP-seq
MIRT922598	hsa-miR-4722-3p	CLIP-seq
MIRT922599	hsa-miR-4728-5p	CLIP-seq
MIRT922600	hsa-miR-4735-5p	CLIP-seq
MIRT922601	hsa-miR-4736	CLIP-seq
MIRT922602	hsa-miR-4743	CLIP-seq
MIRT922603	hsa-miR-4755-5p	CLIP-seq
MIRT922604	hsa-miR-4763-3p	CLIP-seq
MIRT922605	hsa-miR-4773	CLIP-seq
MIRT922606	hsa-miR-4797-5p	CLIP-seq
MIRT922607	hsa-miR-485-5p	CLIP-seq
MIRT922608	hsa-miR-486-3p	CLIP-seq
MIRT922609	hsa-miR-518a-5p	CLIP-seq
MIRT922610	hsa-miR-527	CLIP-seq
MIRT922611	hsa-miR-574-5p	CLIP-seq
MIRT922612	hsa-miR-576-5p	CLIP-seq
MIRT922613	hsa-miR-602	CLIP-seq
MIRT922614	hsa-miR-604	CLIP-seq
MIRT922615	hsa-miR-647	CLIP-seq
MIRT922616	hsa-miR-661	CLIP-seq
MIRT922617	hsa-miR-670	CLIP-seq
MIRT922618	hsa-miR-764	CLIP-seq
MIRT922619	hsa-miR-885-3p	CLIP-seq
MIRT922620	hsa-miR-924	CLIP-seq
MIRT922621	hsa-miR-92a	CLIP-seq
MIRT922622	hsa-miR-92b	CLIP-seq
MIRT922623	hsa-miR-940	CLIP-seq
MIRT1973255	hsa-miR-1178	CLIP-seq
MIRT922552	hsa-miR-1207-5p	CLIP-seq
MIRT1973256	hsa-miR-1253	CLIP-seq
MIRT1973257	hsa-miR-1266	CLIP-seq
MIRT1973258	hsa-miR-1268	CLIP-seq
MIRT1973259	hsa-miR-1268b	CLIP-seq
MIRT1973260	hsa-miR-1275	CLIP-seq
MIRT1973261	hsa-miR-1285	CLIP-seq
MIRT922554	hsa-miR-1827	CLIP-seq
MIRT1973262	hsa-miR-185	CLIP-seq
MIRT1973263	hsa-miR-190	CLIP-seq
MIRT1973264	hsa-miR-190b	CLIP-seq
MIRT1973265	hsa-miR-1912	CLIP-seq
MIRT1973266	hsa-miR-1915	CLIP-seq
MIRT922558	hsa-miR-2278	CLIP-seq
MIRT922559	hsa-miR-25	CLIP-seq
MIRT1973267	hsa-miR-29a	CLIP-seq
MIRT1973268	hsa-miR-29b	CLIP-seq
MIRT1973269	hsa-miR-29c	CLIP-seq
MIRT1973270	hsa-miR-3065-3p	CLIP-seq
MIRT1973271	hsa-miR-3121-5p	CLIP-seq
MIRT1973272	hsa-miR-3130-5p	CLIP-seq
MIRT1973273	hsa-miR-3136-3p	CLIP-seq
MIRT1973274	hsa-miR-3150a-3p	CLIP-seq
MIRT1973275	hsa-miR-3175	CLIP-seq
MIRT1973276	hsa-miR-3187-5p	CLIP-seq
MIRT1973277	hsa-miR-3194-5p	CLIP-seq
MIRT922563	hsa-miR-32	CLIP-seq
MIRT1973278	hsa-miR-3201	CLIP-seq
MIRT1973279	hsa-miR-323-3p	CLIP-seq
MIRT922565	hsa-miR-3591-3p	CLIP-seq
MIRT1973280	hsa-miR-3605-5p	CLIP-seq
MIRT922566	hsa-miR-3611	CLIP-seq
MIRT922569	hsa-miR-363	CLIP-seq
MIRT922572	hsa-miR-367	CLIP-seq
MIRT1973281	hsa-miR-3670	CLIP-seq
MIRT922573	hsa-miR-3689a-3p	CLIP-seq
MIRT922574	hsa-miR-3689c	CLIP-seq
MIRT922576	hsa-miR-3918	CLIP-seq
MIRT1973282	hsa-miR-4274	CLIP-seq
MIRT1973283	hsa-miR-4284	CLIP-seq
MIRT1973284	hsa-miR-4306	CLIP-seq
MIRT1973285	hsa-miR-4437	CLIP-seq
MIRT1973286	hsa-miR-4449	CLIP-seq
MIRT1973287	hsa-miR-4482	CLIP-seq
MIRT1973288	hsa-miR-4492	CLIP-seq
MIRT1973289	hsa-miR-4498	CLIP-seq
MIRT1973290	hsa-miR-4505	CLIP-seq
MIRT1973291	hsa-miR-4512	CLIP-seq
MIRT922586	hsa-miR-4514	CLIP-seq
MIRT1973292	hsa-miR-4518	CLIP-seq
MIRT1973293	hsa-miR-4525	CLIP-seq
MIRT1973294	hsa-miR-4644	CLIP-seq
MIRT1973295	hsa-miR-4655-5p	CLIP-seq
MIRT1973296	hsa-miR-4665-5p	CLIP-seq
MIRT922591	hsa-miR-4677-3p	CLIP-seq
MIRT922592	hsa-miR-4679	CLIP-seq
MIRT1973297	hsa-miR-4685-5p	CLIP-seq
MIRT1973298	hsa-miR-4687-5p	CLIP-seq
MIRT922594	hsa-miR-4691-3p	CLIP-seq
MIRT922595	hsa-miR-4691-5p	CLIP-seq
MIRT922596	hsa-miR-4692	CLIP-seq
MIRT922597	hsa-miR-4709-3p	CLIP-seq
MIRT1973299	hsa-miR-4723-5p	CLIP-seq
MIRT922599	hsa-miR-4728-5p	CLIP-seq
MIRT1973300	hsa-miR-4731-5p	CLIP-seq
MIRT1973301	hsa-miR-4733-3p	CLIP-seq
MIRT922604	hsa-miR-4763-3p	CLIP-seq
MIRT1973302	hsa-miR-4791	CLIP-seq
MIRT922606	hsa-miR-4797-5p	CLIP-seq
MIRT1973303	hsa-miR-520d-5p	CLIP-seq
MIRT1973304	hsa-miR-524-5p	CLIP-seq
MIRT1973305	hsa-miR-548c-3p	CLIP-seq
MIRT1973306	hsa-miR-612	CLIP-seq
MIRT1973307	hsa-miR-625	CLIP-seq
MIRT1973308	hsa-miR-762	CLIP-seq
MIRT1973309	hsa-miR-766	CLIP-seq
MIRT922619	hsa-miR-885-3p	CLIP-seq
MIRT922620	hsa-miR-924	CLIP-seq
MIRT922621	hsa-miR-92a	CLIP-seq
MIRT922622	hsa-miR-92b	CLIP-seq
MIRT1973310	hsa-miR-939	CLIP-seq
MIRT1973257	hsa-miR-1266	CLIP-seq
MIRT2208903	hsa-miR-1271	CLIP-seq
MIRT2208904	hsa-miR-1324	CLIP-seq
MIRT2208905	hsa-miR-182	CLIP-seq
MIRT922554	hsa-miR-1827	CLIP-seq
MIRT1973265	hsa-miR-1912	CLIP-seq
MIRT2208906	hsa-miR-2115	CLIP-seq
MIRT922559	hsa-miR-25	CLIP-seq
MIRT922560	hsa-miR-302f	CLIP-seq
MIRT2208907	hsa-miR-3191	CLIP-seq
MIRT922563	hsa-miR-32	CLIP-seq
MIRT2208908	hsa-miR-34a	CLIP-seq
MIRT2208909	hsa-miR-34c-5p	CLIP-seq
MIRT922565	hsa-miR-3591-3p	CLIP-seq
MIRT922567	hsa-miR-3622a-3p	CLIP-seq
MIRT922568	hsa-miR-3622b-3p	CLIP-seq
MIRT922569	hsa-miR-363	CLIP-seq
MIRT922572	hsa-miR-367	CLIP-seq
MIRT922573	hsa-miR-3689a-3p	CLIP-seq
MIRT922574	hsa-miR-3689c	CLIP-seq
MIRT2208910	hsa-miR-449a	CLIP-seq
MIRT2208911	hsa-miR-449b	CLIP-seq
MIRT1973292	hsa-miR-4518	CLIP-seq
MIRT922594	hsa-miR-4691-3p	CLIP-seq
MIRT922599	hsa-miR-4728-5p	CLIP-seq
MIRT2208912	hsa-miR-4757-5p	CLIP-seq
MIRT922605	hsa-miR-4773	CLIP-seq
MIRT922606	hsa-miR-4797-5p	CLIP-seq
MIRT2208913	hsa-miR-491-5p	CLIP-seq
MIRT2208914	hsa-miR-516a-3p	CLIP-seq
MIRT922609	hsa-miR-518a-5p	CLIP-seq
MIRT922610	hsa-miR-527	CLIP-seq
MIRT2208915	hsa-miR-587	CLIP-seq
MIRT2208916	hsa-miR-646	CLIP-seq
MIRT922619	hsa-miR-885-3p	CLIP-seq
MIRT922620	hsa-miR-924	CLIP-seq
MIRT922621	hsa-miR-92a	CLIP-seq
MIRT922622	hsa-miR-92b	CLIP-seq
MIRT2208917	hsa-miR-96	CLIP-seq
MIRT2386685	hsa-miR-1234	CLIP-seq
MIRT2386686	hsa-miR-1307	CLIP-seq
MIRT1973263	hsa-miR-190	CLIP-seq
MIRT1973264	hsa-miR-190b	CLIP-seq
MIRT2386687	hsa-miR-2276	CLIP-seq
MIRT922559	hsa-miR-25	CLIP-seq
MIRT922563	hsa-miR-32	CLIP-seq
MIRT1973278	hsa-miR-3201	CLIP-seq
MIRT1973279	hsa-miR-323-3p	CLIP-seq
MIRT922565	hsa-miR-3591-3p	CLIP-seq
MIRT2386688	hsa-miR-3615	CLIP-seq
MIRT2386689	hsa-miR-3620	CLIP-seq
MIRT922569	hsa-miR-363	CLIP-seq
MIRT922572	hsa-miR-367	CLIP-seq
MIRT1973281	hsa-miR-3670	CLIP-seq
MIRT2386690	hsa-miR-4324	CLIP-seq
MIRT2386691	hsa-miR-4638-5p	CLIP-seq
MIRT922594	hsa-miR-4691-3p	CLIP-seq
MIRT2386692	hsa-miR-4695-5p	CLIP-seq
MIRT2386693	hsa-miR-4708-3p	CLIP-seq
MIRT922605	hsa-miR-4773	CLIP-seq
MIRT1973302	hsa-miR-4791	CLIP-seq
MIRT922606	hsa-miR-4797-5p	CLIP-seq
MIRT922608	hsa-miR-486-3p	CLIP-seq
MIRT2386694	hsa-miR-582-5p	CLIP-seq
MIRT922613	hsa-miR-602	CLIP-seq
MIRT922620	hsa-miR-924	CLIP-seq
MIRT922621	hsa-miR-92a	CLIP-seq
MIRT922622	hsa-miR-92b	CLIP-seq
MIRT1973279	hsa-miR-323-3p	CLIP-seq
MIRT922565	hsa-miR-3591-3p	CLIP-seq
MIRT2428118	hsa-miR-4662a-3p	CLIP-seq
MIRT2428119	hsa-miR-4771	CLIP-seq
MIRT2428120	hsa-miR-499a-5p	CLIP-seq
MIRT1973303	hsa-miR-520d-5p	CLIP-seq
MIRT1973304	hsa-miR-524-5p	CLIP-seq
MIRT2386694	hsa-miR-582-5p	CLIP-seq
MIRT1973273	hsa-miR-3136-3p	CLIP-seq
MIRT922581	hsa-miR-4292	CLIP-seq
MIRT922582	hsa-miR-4308	CLIP-seq
MIRT2447988	hsa-miR-4456	CLIP-seq
MIRT2447989	hsa-miR-4527	CLIP-seq
MIRT922591	hsa-miR-4677-3p	CLIP-seq
MIRT922592	hsa-miR-4679	CLIP-seq
MIRT2447990	hsa-miR-663b	CLIP-seq
MIRT922562	hsa-miR-3189-3p	CLIP-seq
MIRT2512770	hsa-miR-4300	CLIP-seq
MIRT2512771	hsa-miR-4487	CLIP-seq
MIRT1973303	hsa-miR-520d-5p	CLIP-seq
MIRT1973304	hsa-miR-524-5p	CLIP-seq
MIRT2512772	hsa-miR-583	CLIP-seq
MIRT922616	hsa-miR-661	CLIP-seq
MIRT2512773	hsa-miR-920	CLIP-seq
MIRT1973310	hsa-miR-939	CLIP-seq
MIRT2679012	hsa-miR-1207-3p	CLIP-seq
MIRT2386687	hsa-miR-2276	CLIP-seq
MIRT2679013	hsa-miR-4436b-3p	CLIP-seq
MIRT2386693	hsa-miR-4708-3p	CLIP-seq

149

Show/Hide all (149)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15310755
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20154697
GO:0001525	Process	Angiogenesis	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	IMP	29156729
GO:0005123	Function	Death receptor binding	IPI	15310755
GO:0005515	Function	Protein binding	IPI	12813029, 17389591, 19903888, 20080667, 32296183
GO:0005737	Component	Cytoplasm	IDA	15310755, 19948740, 29156729
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15310755, 19948740, 29156729
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19903888
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IMP	19903888
GO:0010596	Process	Negative regulation of endothelial cell migration	IEA
GO:0010596	Process	Negative regulation of endothelial cell migration	IMP	19033661
GO:0010633	Process	Negative regulation of epithelial cell migration	IMP	20080667
GO:0010633	Process	Negative regulation of epithelial cell migration	TAS	20080667
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	20154697
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	20080667
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IDA	29156729
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	19033661
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0017124	Function	SH3 domain binding	IDA	19033661
GO:0019900	Function	Kinase binding	IPI	17389591
GO:0019901	Function	Protein kinase binding	IDA	18281285
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	20080667
GO:0021814	Process	Cell motility involved in cerebral cortex radial glia guided migration	IEA
GO:0021814	Process	Cell motility involved in cerebral cortex radial glia guided migration	ISS
GO:0021819	Process	Layer formation in cerebral cortex	IEA
GO:0021819	Process	Layer formation in cerebral cortex	ISS
GO:0030139	Component	Endocytic vesicle	IDA	19948740
GO:0030163	Process	Protein catabolic process	IDA	17389591
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030948	Process	Negative regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0030948	Process	Negative regulation of vascular endothelial growth factor receptor signaling pathway	IMP	19033661
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	18281285
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IPI	17389591
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IPI	12813029
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	19948740
GO:0032809	Component	Neuronal cell body membrane	IEA
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	12813029
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IDA	19948740
GO:0034260	Process	Negative regulation of GTPase activity	ISS
GO:0034620	Process	Cellular response to unfolded protein	TAS	22013210
GO:0035148	Process	Tube formation	IEA
GO:0035148	Process	Tube formation	IMP	19033661
GO:0035556	Process	Intracellular signal transduction	IMP	20080667
GO:0035591	Function	Signaling adaptor activity	IDA	19903888, 20080667
GO:0035662	Function	Toll-like receptor 4 binding	IDA	19948740
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	19033661
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	ISS
GO:0036312	Function	Phosphatidylinositol 3-kinase regulatory subunit binding	IDA	19903888
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	IEA
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	ISS
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	ISS	11812785
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	19903888
GO:0042802	Function	Identical protein binding	IPI	12813029
GO:0042803	Function	Protein homodimerization activity	IPI	12813029
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	17389591, 19903888
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043087	Process	Regulation of GTPase activity	ISS
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	15310755, 17389591
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	19033661
GO:0043254	Process	Regulation of protein-containing complex assembly	IDA	19948740
GO:0043254	Process	Regulation of protein-containing complex assembly	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	IMP	20154697
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	19903888
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	19903888
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IDA	19033661
GO:0044300	Component	Cerebellar mossy fiber	IEA
GO:0044300	Component	Cerebellar mossy fiber	ISS
GO:0044301	Component	Climbing fiber	IEA
GO:0044301	Component	Climbing fiber	ISS
GO:0044877	Function	Protein-containing complex binding	IDA	19903888
GO:0045087	Process	Innate immune response	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20080667
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15310755, 17389591
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12813029, 15310755, 17389591, 19903888
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IMP	20154697
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	ISS
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IMP	20154697
GO:0051721	Function	Protein phosphatase 2A binding	IPI	20080667
GO:0051726	Process	Regulation of cell cycle	IDA	19903888
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19903888
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	18281285
GO:0070273	Function	Phosphatidylinositol-4-phosphate binding	IDA	19948740
GO:0070317	Process	Negative regulation of G0 to G1 transition	IDA	19903888
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	19903888
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	19948740
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071347	Process	Cellular response to interleukin-1	IDA	19948740
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	12813029, 15310755, 17389591
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	ISS	11812785
GO:0071889	Function	14-3-3 protein binding	IDA	17389591
GO:0072577	Process	Endothelial cell apoptotic process	TAS	19903888
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	20080667
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0090129	Process	Positive regulation of synapse maturation	IEA
GO:0090129	Process	Positive regulation of synapse maturation	ISS
GO:0140042	Process	Lipid droplet formation	IMP	29156729
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1900006	Process	Positive regulation of dendrite development	ISS
GO:1900744	Process	Regulation of p38MAPK cascade	IEA
GO:1900744	Process	Regulation of p38MAPK cascade	ISS
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	ISS
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IMP	20154697
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IMP	20080667
GO:1902531	Process	Regulation of intracellular signal transduction	IBA
GO:1903896	Process	Positive regulation of IRE1-mediated unfolded protein response	TAS	22013210
GO:1990032	Component	Parallel fiber	IEA
GO:1990032	Component	Parallel fiber	ISS
GO:1990597	Component	AIP1-IRE1 complex	IDA	18281285
GO:1990597	Component	AIP1-IRE1 complex	IEA
GO:2001224	Process	Positive regulation of neuron migration	IEA
GO:2001224	Process	Positive regulation of neuron migration	ISS
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	19903888

MIM	HGNC	e!Ensembl
609205	17294	ENSG00000136848

Q5VWQ8

Protein name

Disabled homolog 2-interacting protein (DAB2 interaction protein) (DAB2-interacting protein) (ASK-interacting protein 1) (AIP-1) (DOC-2/DAB-2 interactive protein)

Protein function

Functions as a scaffold protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Involved in several processes such as innate immune response, inflammation and cell growth inhibition, apoptosis

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	213 → 313	C2 domain	Domain
PF00616	RasGAP	392 → 470	GTPase-activator protein for Ras-like GTPase	Family
PF00616	RasGAP	460 → 563	GTPase-activator protein for Ras-like GTPase	Family
PF12004	DUF3498	646 → 1159	Domain of unknown function (DUF3498)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial and vascular smooth muscle cells (VSMCs). Expressed in prostate epithelial but poorly in prostate cancer cells. Poorly expressed in medulloblastoma cells compared to cerebellar precursor proliferating progenito

Sequence

MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSE
KSPSMEPSAATPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNE
RSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSK
CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
LYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLC
AALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFC
KIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQ
EYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
LSNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTPGSGQ
LPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQ
PSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQ
LVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP
LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKG
GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDW
VGPSTRLRQQSSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLG
PDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQAR
LEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIAS
LDAANARLMSALTQLKERYSMQARNGISPTNPTKLQITENGEFRNSSNC

Sequence length

1189

Interactions

View interactions

	KEGG		Reactome
	Apoptosis TNF signaling pathway		Regulation of RAS by GAPs

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Gastric cancer	Likely benign	rs144586865	RCV005927605
Keratoconus	Uncertain significance	rs765361316	RCV000678671

Show/Hide Text Mining Associations (45)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	33083483, 36928034
Aortic Aneurysm Abdominal	Associate	20622881, 37893562
Aortic Aneurysm Abdominal	Stimulate	31028191
Aortic Aneurysm Familial Abdominal 1	Associate	20622881
Aortic Dissection	Associate	33083483
Arrhythmogenic Right Ventricular Dysplasia	Associate	29221435
Breast Neoplasms	Associate	25287138, 28167613
Cap Myopathy	Associate	22077888
Carcinogenesis	Associate	24912918, 27036023, 34775484
Carcinoma Hepatocellular	Associate	21067840, 27768594, 38015711
Carcinoma Renal Cell	Associate	26587829, 27129174, 32583730, 35562342
Chromosomal Instability	Associate	34775484
Chronic Periodontitis	Associate	25056994
Colorectal Neoplasms	Associate	31081086, 35063646, 36939385
Colorectal Neoplasms	Inhibit	35590292
Coronary Artery Disease	Associate	28167353, 28962556, 30595311
Coronary Disease	Associate	21444365, 30595311
Depressive Disorder Major	Associate	36928034
Diabetes Mellitus Type 2	Associate	35712257
Endometrial Neoplasms	Associate	27907910
Esophageal Neoplasms	Associate	25841337, 30402845
Esophageal Squamous Cell Carcinoma	Associate	25841337
Glioblastoma	Associate	32943609, 37443071
Hypospadias	Associate	35606856
Inflammation	Associate	35712257, 36939385
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19543515
Leukemia Myeloid Acute	Associate	19543515
Lung Neoplasms	Associate	22046421
Multiple Organ Failure	Associate	39272989
Myocardial Infarction	Associate	20622881
Neoplasm Metastasis	Associate	24912918, 27036023, 32583730, 38015711
Neoplasm Metastasis	Inhibit	28167613
Neoplasms	Inhibit	15770214, 22046421, 24073285, 24684735, 24912918, 26471467, 27129174, 32583730, 34775484, 35590292, 36939385
Neoplasms	Associate	21067840, 22077888, 25287138, 26587829, 27036023, 31666665, 35063646
Obesity	Inhibit	35712257
Overweight	Associate	22046421
Periodontitis	Associate	25056994
Peripheral Arterial Disease	Associate	20622881
Personality Disorders	Associate	22046421
Prostatic Neoplasms	Inhibit	15817459, 34775484
Prostatic Neoplasms	Associate	21538423, 22046421, 22077888, 23308052, 24867541, 26471467
Pulmonary Embolism	Associate	20622881
Radiation Injuries	Associate	28586028
Stomach Neoplasms	Associate	31713929
Urinary Bladder Neoplasms	Associate	24684735, 28586028

DAB2IP (DAB2 interacting protein)