Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1524
Gene name Gene Name - the full gene name approved by the HGNC.	C-X3-C motif chemokine receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CX3CR1
Synonyms (NCBI Gene) Gene synonyms aliases	CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs3732378	G>A	Protective, risk-factor, pathogenic	Coding sequence variant, missense variant
rs3732379	C>T	Protective, risk-factor, pathogenic	Coding sequence variant, missense variant

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT917546	hsa-miR-1207-5p	CLIP-seq
MIRT917547	hsa-miR-1236	CLIP-seq
MIRT917548	hsa-miR-127-5p	CLIP-seq
MIRT917549	hsa-miR-204	CLIP-seq
MIRT917550	hsa-miR-211	CLIP-seq
MIRT917551	hsa-miR-3155	CLIP-seq
MIRT917552	hsa-miR-3155b	CLIP-seq
MIRT917553	hsa-miR-3163	CLIP-seq
MIRT917554	hsa-miR-3168	CLIP-seq
MIRT917555	hsa-miR-3924	CLIP-seq
MIRT917556	hsa-miR-4446-5p	CLIP-seq
MIRT917557	hsa-miR-4496	CLIP-seq
MIRT917558	hsa-miR-4639-5p	CLIP-seq
MIRT917559	hsa-miR-4738-3p	CLIP-seq
MIRT917560	hsa-miR-4755-5p	CLIP-seq
MIRT917561	hsa-miR-4763-3p	CLIP-seq
MIRT917562	hsa-miR-484	CLIP-seq
MIRT917563	hsa-miR-623	CLIP-seq
MIRT2465153	hsa-miR-3125	CLIP-seq
MIRT2465154	hsa-miR-3916	CLIP-seq
MIRT2465155	hsa-miR-570	CLIP-seq

Show/Hide all(109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	ISS
GO:0002282	Process	Microglial cell activation involved in immune response	IEA
GO:0002282	Process	Microglial cell activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004950	Function	Chemokine receptor activity	TAS	10754298
GO:0005515	Function	Protein binding	IPI	9931005, 32296183
GO:0005886	Component	Plasma membrane	IDA	12055230
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9390561
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IGI	16019082
GO:0006935	Process	Chemotaxis	TAS	10754298
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	ISS
GO:0006968	Process	Cellular defense response	TAS	10754298
GO:0007155	Process	Cell adhesion	IDA	9782118
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007155	Process	Cell adhesion	TAS	10754298
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10754298
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007267	Process	Cell-cell signaling	TAS	24352739
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	TAS	24352739
GO:0009611	Process	Response to wounding	TAS	10754298
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	28791023
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS	10415068
GO:0009986	Component	Cell surface	TAS	24352739
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016495	Function	C-X3-C chemokine receptor activity	IDA	9782118, 12055230
GO:0016495	Function	C-X3-C chemokine receptor activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019960	Function	C-X3-C chemokine binding	IDA	23125415
GO:0019960	Function	C-X3-C chemokine binding	IEA
GO:0019960	Function	C-X3-C chemokine binding	ISS
GO:0021626	Process	Central nervous system maturation	IEA
GO:0021626	Process	Central nervous system maturation	ISS
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0030595	Process	Leukocyte chemotaxis	ISS
GO:0031737	Function	CX3C chemokine receptor binding	IDA	9782118
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0035176	Process	Social behavior	IEA
GO:0035176	Process	Social behavior	ISS
GO:0035425	Process	Autocrine signaling	ISS
GO:0043005	Component	Neuron projection	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0045087	Process	Innate immune response	IC	23499256
GO:0045087	Process	Innate immune response	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0048167	Process	Regulation of synaptic plasticity	TAS	24352739
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048874	Process	Host-mediated modulation of intestinal microbiota composition	IEA
GO:0048874	Process	Host-mediated modulation of intestinal microbiota composition	ISS
GO:0050767	Process	Regulation of neurogenesis	TAS	24352739
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	ISS
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050901	Process	Leukocyte tethering or rolling	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060074	Process	Synapse maturation	IEA
GO:0060074	Process	Synapse maturation	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	IMP	29326275
GO:0061760	Process	Antifungal innate immune response	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0097447	Component	Dendritic tree	ISS
GO:0098883	Process	Synapse pruning	IC
GO:0098883	Process	Synapse pruning	IEA
GO:0098883	Process	Synapse pruning	ISS
GO:0110091	Process	Negative regulation of hippocampal neuron apoptotic process	ISS
GO:0150090	Process	Multiple spine synapse organization, single dendrite	IEA
GO:0150090	Process	Multiple spine synapse organization, single dendrite	ISS
GO:0160056	Component	Macropinosome membrane	TAS
GO:1904139	Process	Regulation of microglial cell migration	TAS	24352739
GO:1904150	Process	Negative regulation of microglial cell mediated cytotoxicity	IEA
GO:1904150	Process	Negative regulation of microglial cell mediated cytotoxicity	ISS
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
601470	2558	ENSG00000168329

Protein

UniProt ID

P49238

Protein name

CX3C chemokine receptor 1 (C-X3-C CKR-1) (CX3CR1) (Beta chemokine receptor-like 1) (CMK-BRL-1) (CMK-BRL1) (Fractalkine receptor) (G-protein coupled receptor 13) (V28)

Protein function

Receptor for the C-X3-C chemokine fractalkine (CX3CL1) present on many early leukocyte cells; CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis

PDB

7XBW , 7XBX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	48 → 293	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in lymphoid and neural tissues (PubMed:7590284). Expressed in lymphocyte subsets, such as natural killer (NK) cells, gamma-delta T-cells and terminally differentiated CD8(+) T-cells (PubMed:12055230). Expressed in smooth musc

Sequence

MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

Sequence length

355

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Efferocytosis		Chemokine receptors bind chemokines G alpha (i) signalling events

CX3CR1 (C-X3-C motif chemokine receptor 1)