TAFA4 (TAFA chemokine like family member 4)

Gene

• Entrez ID: 151647
• Gene name: TAFA chemokine like family member 4
• Gene symbol: TAFA4
• Synonyms (NCBI Gene): FAM19A4, TAFA-4
• Chromosome: 3
• Chromosome location: 3p14.1
• Summary: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	29453251
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0006909	Process	Phagocytosis	IBA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0010469	Process	Regulation of signaling receptor activity	ISS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0042554	Process	Superoxide anion generation	ISS
GO:0048018	Function	Receptor ligand activity	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0048246	Process	Macrophage chemotaxis	IBA
GO:0048246	Process	Macrophage chemotaxis	IEA
GO:0048246	Process	Macrophage chemotaxis	ISS
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 617498
• HGNC: 21591
• e!Ensembl: ENSG00000163377

Protein

• UniProt ID: Q96LR4
• Protein name: Chemokine-like protein TAFA-4
• Protein function: Modulates injury-induced and chemical pain hypersensitivity (By similarity). Ligand of FPR1, can chemoattract macrophages, promote phagocytosis and increase ROS release (PubMed:25109685). {ECO:0000250|UniProtKB:Q7TPG5, ECO:0000269|PubMed:2510968
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12020	TAFA	50 → 138	TAFA family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain (PubMed:15028294). Expressed in LPS-stimulated monocytes and macrophages, especially in polarized M1 (PubMed:25109685). {ECO:0000269|PubMed:15028294, ECO:0000269|PubMed:25109685}.
• Sequence:

  MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHR
  CCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLP
  DYSGWSCSSGNKVKTTKVTR

• Sequence length: 140