Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	151306
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled bile acid receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPBAR1
Synonyms (NCBI Gene) Gene synonyms aliases	BG37, GPCR19, GPR131, M-BAR, TGR5
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q35
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activat

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017548	hsa-miR-335-5p	Microarray	18185580
MIRT1028436	hsa-miR-1538	CLIP-seq
MIRT1028437	hsa-miR-214	CLIP-seq
MIRT1028438	hsa-miR-2467-3p	CLIP-seq
MIRT1028439	hsa-miR-3151	CLIP-seq
MIRT1028440	hsa-miR-3619-5p	CLIP-seq
MIRT1028441	hsa-miR-3667-3p	CLIP-seq
MIRT1028442	hsa-miR-3919	CLIP-seq
MIRT1028443	hsa-miR-4291	CLIP-seq
MIRT1028444	hsa-miR-4745-3p	CLIP-seq
MIRT1028445	hsa-miR-4795-5p	CLIP-seq
MIRT1028446	hsa-miR-520a-5p	CLIP-seq
MIRT1028447	hsa-miR-525-5p	CLIP-seq
MIRT1028448	hsa-miR-640	CLIP-seq
MIRT1028449	hsa-miR-761	CLIP-seq
MIRT1028450	hsa-miR-922	CLIP-seq
MIRT1028437	hsa-miR-214	CLIP-seq
MIRT2005086	hsa-miR-3194-3p	CLIP-seq
MIRT1028440	hsa-miR-3619-5p	CLIP-seq
MIRT1028443	hsa-miR-4291	CLIP-seq
MIRT2005087	hsa-miR-4490	CLIP-seq
MIRT2005088	hsa-miR-4774-5p	CLIP-seq
MIRT1028449	hsa-miR-761	CLIP-seq
MIRT1028450	hsa-miR-922	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IDA	12524422
GO:0005886	Component	Plasma membrane	IDA	12419312, 12524422
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0038181	Function	Bile acid receptor activity	IDA	12419312
GO:0038182	Function	G protein-coupled bile acid receptor activity	IDA	12524422
GO:0038182	Function	G protein-coupled bile acid receptor activity	NAS	12419312
GO:0038184	Process	Cell surface bile acid receptor signaling pathway	IDA	12419312, 12524422
GO:0043235	Component	Receptor complex	IDA	12419312, 12524422
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903413	Process	Cellular response to bile acid	IDA	12419312, 12524422
GO:1904056	Process	Positive regulation of cholangiocyte proliferation	IEA
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA

MIM	HGNC	e!Ensembl
610147	19680	ENSG00000179921

Protein

UniProt ID

Q8TDU6

Protein name

G-protein coupled bile acid receptor 1 (G-protein coupled receptor GPCR19) (hGPCR19) (Membrane-type receptor for bile acids) (M-BAR) (hBG37) (BG37)

Protein function

Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. {ECO:0000269|

PDB

7BW0 , 7CFM , 7CFN , 7XTQ , 9GYO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	31 → 278	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse col

Sequence

MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Sequence length

330

Interactions

View interactions

	Reactome
			Class A/1 (Rhodopsin-like receptors) G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease, Regional enteritis	23566200	ClinVar
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	19926617, 27510297, 28212604, 28293080, 34222478
Barrett Esophagus	Associate	27511066, 28293080
Behcet Syndrome	Associate	35864954
Carcinogenesis	Associate	24465162
Carcinoma Hepatocellular	Associate	24465162
Carcinoma Pancreatic Ductal	Associate	24520077
Cardiomegaly	Inhibit	30842472
Chemical and Drug Induced Liver Injury	Stimulate	26045278
Cholangiocarcinoma	Associate	26045278, 37774230
Cholangitis Sclerosing	Associate	26045278
Colorectal Neoplasms	Associate	24520077
Cysts	Stimulate	26045278
Diabetes Mellitus Type 2	Associate	30792450
Diabetic Cardiomyopathies	Associate	30842472
Esophageal Neoplasms	Associate	28212604
Fatty Liver Alcoholic	Associate	30792450
Gastrointestinal Diseases	Associate	21883702
Hyperbilirubinemia	Associate	27510297
Hyperglycemia	Associate	30842472
Hypertrophy	Inhibit	30842472
Inflammation	Associate	34239273
Inflammatory Bowel Diseases	Associate	21883702
Irritable Bowel Syndrome	Associate	21883702, 25012842
Leukemia Lymphocytic Chronic B Cell	Associate	37646669
Liver Diseases	Associate	26045278
Liver Neoplasms	Inhibit	24465162
Metabolic Diseases	Associate	30792450
Mouth Neoplasms	Associate	28293080
Neoplasms	Inhibit	27510297
Neoplasms	Associate	36834607
Obesity	Associate	23523790, 30792450
Ovarian Neoplasms	Associate	27510297
Polycystic liver disease	Associate	26045278
Precancerous Conditions	Associate	28212604
Retinal Dysplasia	Associate	28293080
Stomach Neoplasms	Associate	26417930, 27510297
Uveitis	Associate	35864954
Weight Loss	Associate	23523790

GPBAR1 (G protein-coupled bile acid receptor 1)