Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	151306
Gene name	G protein-coupled bile acid receptor 1
Gene symbol	GPBAR1
Synonyms (NCBI Gene)	BG37GPCR19GPR131M-BARTGR5
Chromosome	2
Chromosome location	2q35
Summary	This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activat

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017548	hsa-miR-335-5p	Microarray	18185580
MIRT1028436	hsa-miR-1538	CLIP-seq
MIRT1028437	hsa-miR-214	CLIP-seq
MIRT1028438	hsa-miR-2467-3p	CLIP-seq
MIRT1028439	hsa-miR-3151	CLIP-seq
MIRT1028440	hsa-miR-3619-5p	CLIP-seq
MIRT1028441	hsa-miR-3667-3p	CLIP-seq
MIRT1028442	hsa-miR-3919	CLIP-seq
MIRT1028443	hsa-miR-4291	CLIP-seq
MIRT1028444	hsa-miR-4745-3p	CLIP-seq
MIRT1028445	hsa-miR-4795-5p	CLIP-seq
MIRT1028446	hsa-miR-520a-5p	CLIP-seq
MIRT1028447	hsa-miR-525-5p	CLIP-seq
MIRT1028448	hsa-miR-640	CLIP-seq
MIRT1028449	hsa-miR-761	CLIP-seq
MIRT1028450	hsa-miR-922	CLIP-seq
MIRT1028437	hsa-miR-214	CLIP-seq
MIRT2005086	hsa-miR-3194-3p	CLIP-seq
MIRT1028440	hsa-miR-3619-5p	CLIP-seq
MIRT1028443	hsa-miR-4291	CLIP-seq
MIRT2005087	hsa-miR-4490	CLIP-seq
MIRT2005088	hsa-miR-4774-5p	CLIP-seq
MIRT1028449	hsa-miR-761	CLIP-seq
MIRT1028450	hsa-miR-922	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	31978385
GO:0005737	Component	Cytoplasm	IDA	12524422
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12419312, 12524422
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0038182	Function	G protein-coupled bile acid receptor activity	IBA
GO:0038182	Function	G protein-coupled bile acid receptor activity	IDA	12524422
GO:0038182	Function	G protein-coupled bile acid receptor activity	NAS	12419312
GO:0038184	Process	Adenylate cyclase-activating G protein-coupled bile acid receptor signaling pathway	IBA
GO:0038184	Process	Adenylate cyclase-activating G protein-coupled bile acid receptor signaling pathway	IDA	12419312, 12524422
GO:0043235	Component	Receptor complex	IDA	12419312, 12524422
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903413	Process	Cellular response to bile acid	IDA	12419312, 12524422
GO:1904056	Process	Positive regulation of cholangiocyte proliferation	IEA
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA

MIM	HGNC	e!Ensembl
610147	19680	ENSG00000179921

Q8TDU6

Protein name

G-protein coupled bile acid receptor 1 (G-protein coupled receptor GPCR19) (hGPCR19) (Membrane-type receptor for bile acids) (M-BAR) (hBG37) (BG37)

Protein function

Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. {ECO:0000269|

PDB

7BW0 , 7CFM , 7CFN , 7XTQ , 9GYO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	31 → 278	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse col

Sequence

MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Sequence length

330

Interactions

View interactions

	Reactome
			Class A/1 (Rhodopsin-like receptors) G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
GPBAR1-related disorder	Uncertain significance; Likely benign; Benign	rs201272591, rs907641202, rs540933933, rs201236854, rs376966143, rs958463098, rs1198581043, rs1156510444, rs759826576, rs756161981, rs945931617, rs2469238884, rs200024655, rs200340218, rs532575824 View all (42 more)	RCV003410191 RCV003420607 RCV003414073 RCV003393080 RCV003410418 RCV003418858 RCV003898956 RCV003894705 RCV003894018 RCV003904526 RCV003901550 RCV003904054 RCV003913995 RCV003963890 RCV003962152 RCV003969868 RCV003972084 RCV003927214 RCV003939541 RCV003972324 RCV003983659 RCV003957318 RCV003957405 RCV003969774 RCV003954803 RCV003959862 RCV003966882 RCV004750957 RCV003962701 RCV003935615 RCV003915725 RCV003900337 RCV003915726 RCV003905543 RCV003952991 RCV004751621 RCV003900355 RCV003420047 RCV004751625 RCV004751681 RCV003918194 RCV003953306 RCV003947923 RCV003938105 RCV003953317 RCV003892631 RCV003420306 RCV003928237 RCV003955464 RCV003955470 RCV003975285 RCV003975286 RCV003420310 RCV003411683 RCV003947955 RCV003965553 RCV003965555 RCV003957991

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	19926617, 27510297, 28212604, 28293080, 34222478
Barrett Esophagus	Associate	27511066, 28293080
Behcet Syndrome	Associate	35864954
Carcinogenesis	Associate	24465162
Carcinoma Hepatocellular	Associate	24465162
Carcinoma Pancreatic Ductal	Associate	24520077
Cardiomegaly	Inhibit	30842472
Chemical and Drug Induced Liver Injury	Stimulate	26045278
Cholangiocarcinoma	Associate	26045278, 37774230
Cholangitis Sclerosing	Associate	26045278
Colorectal Neoplasms	Associate	24520077
Cysts	Stimulate	26045278
Diabetes Mellitus Type 2	Associate	30792450
Diabetic Cardiomyopathies	Associate	30842472
Esophageal Neoplasms	Associate	28212604
Fatty Liver Alcoholic	Associate	30792450
Gastrointestinal Diseases	Associate	21883702
Hyperbilirubinemia	Associate	27510297
Hyperglycemia	Associate	30842472
Hypertrophy	Inhibit	30842472
Inflammation	Associate	34239273
Inflammatory Bowel Diseases	Associate	21883702
Irritable Bowel Syndrome	Associate	21883702, 25012842
Leukemia Lymphocytic Chronic B Cell	Associate	37646669
Liver Diseases	Associate	26045278
Liver Neoplasms	Inhibit	24465162
Metabolic Diseases	Associate	30792450
Mouth Neoplasms	Associate	28293080
Neoplasms	Inhibit	27510297
Neoplasms	Associate	36834607
Obesity	Associate	23523790, 30792450
Ovarian Neoplasms	Associate	27510297
Polycystic liver disease	Associate	26045278
Precancerous Conditions	Associate	28212604
Retinal Dysplasia	Associate	28293080
Stomach Neoplasms	Associate	26417930, 27510297
Uveitis	Associate	35864954
Weight Loss	Associate	23523790

GPBAR1 (G protein-coupled bile acid receptor 1)