ZNF385B (zinc finger protein 385B)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
151126
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 385B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF385B
Synonyms (NCBI Gene) Gene synonyms aliases
ZNF533
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.2-q31.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(18)
miRTarBase ID miRNA Experiments Reference
MIRT024722 hsa-miR-215-5p Microarray 19074876
MIRT026853 hsa-miR-192-5p Microarray 19074876
MIRT1523592 hsa-miR-1278 CLIP-seq
MIRT1523593 hsa-miR-3120-3p CLIP-seq
MIRT1523594 hsa-miR-325 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0002039 Function P53 binding IPI 22945289
GO:0003676 Function Nucleic acid binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 22945289
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
612344 26332 ENSG00000144331
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q569K4
Protein name Zinc finger protein 385B (Zinc finger protein 533)
Protein function May play a role in p53/TP53-mediated apoptosis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 34 → 58 Domain
PF12874 zf-met 157 → 181 Domain
PF12874 zf-met 285 → 309 Domain
PF12874 zf-met 348 → 372 Domain
Tissue specificity TISSUE SPECIFICITY: Detected in germinal center of lymph node (at protein level). Expressed in spleen, lymph node and tonsil. {ECO:0000269|PubMed:22945289}.
Sequence 
MNMANFLRGFEEKGIKNDRPEDQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRK
RVKQLSDGQPPPPAQASPSSNSSTGSTCHTTTLPALVRTPTLMMQPSLDIKPFMSFPVDS
SSAVGLFPNFNTMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSK
HAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQPSSS
ESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEKAKKLLYCSLCKVAVNSLSQL
EAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHCEICDVHVNSE
IQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSP
LAAAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY
Sequence length 471
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Gout Gout N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (7)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autistic Disorder Associate 24599690
Breast Neoplasms Associate 28145423
Burkitt Lymphoma Associate 22945289
Death Sudden Cardiac Associate 21658281
Nuchal Cord Associate 28600059
Ovarian Neoplasms Associate 23029477
Syndactyly Associate 28600059