Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
149628
Gene name Gene Name - the full gene name approved by the HGNC.
Pyrin and HIN domain family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PYHIN1
Synonyms (NCBI Gene) Gene synonyms aliases
IFIX
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the HIN-200 family of interferon-inducible proteins that share a 200-amino acid signature motif at their C-termini. HIN200 proteins are primarily nuclear and are involved in transcriptional regulation of genes i
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT509223 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT509222 hsa-miR-205-3p HITS-CLIP 21572407
MIRT509221 hsa-miR-190a-3p HITS-CLIP 21572407
MIRT509220 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT509223 hsa-miR-5011-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002218 Process Activation of innate immune response IBA
GO:0002218 Process Activation of innate immune response IEA
GO:0003690 Function Double-stranded DNA binding IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612677 28894 ENSG00000163564
Protein
UniProt ID Q6K0P9
Protein name Pyrin and HIN domain-containing protein 1 (Interferon-inducible protein X)
Protein function Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02758 PYRIN 8 80 PAAD/DAPIN/Pyrin domain Domain
PF02760 HIN 211 379 HIN-200/IF120x domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors. {ECO:0000269|PubMed:15122330}.
Sequence
MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDA
GLGKLIEFFKEIPTLGDLAE
TLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACT
PSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQ
TSSSAPPNTSSTESLKPLANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFH
ATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSLLEVNEASSVSEAGPDQTFEV
PKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGE
CHNIPCEKGDKLRLFCFRL
RKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLS
SDTSTNRHPAVP
Sequence length 492
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 25895113
Breast Neoplasms Inhibit 16479015, 34599264
Carcinogenesis Associate 16479015
Colitis Ulcerative Stimulate 36165492
Inflammatory Bowel Diseases Associate 25895113
Mouth Neoplasms Associate 34599264
Neoplasms Inhibit 34599264
Squamous Cell Carcinoma of Head and Neck Inhibit 34599264
Tuberculosis Associate 31843671