Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	148327
Gene name Gene Name - the full gene name approved by the HGNC.	CAMP responsive element binding protein 3 like 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CREB3L4
Synonyms (NCBI Gene) Gene synonyms aliases	AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments
MIRT908896	hsa-let-7a	CLIP-seq
MIRT908897	hsa-let-7b	CLIP-seq
MIRT908898	hsa-let-7c	CLIP-seq
MIRT908899	hsa-let-7d	CLIP-seq
MIRT908900	hsa-let-7e	CLIP-seq
MIRT908901	hsa-let-7f	CLIP-seq
MIRT908902	hsa-let-7g	CLIP-seq
MIRT908903	hsa-let-7i	CLIP-seq
MIRT908904	hsa-miR-1229	CLIP-seq
MIRT908905	hsa-miR-1304	CLIP-seq
MIRT908906	hsa-miR-1323	CLIP-seq
MIRT908907	hsa-miR-202	CLIP-seq
MIRT908908	hsa-miR-3679-3p	CLIP-seq
MIRT908909	hsa-miR-371b-5p	CLIP-seq
MIRT908910	hsa-miR-4458	CLIP-seq
MIRT908911	hsa-miR-4500	CLIP-seq
MIRT908912	hsa-miR-548ad	CLIP-seq
MIRT908913	hsa-miR-548o	CLIP-seq
MIRT908914	hsa-miR-888	CLIP-seq
MIRT908915	hsa-miR-98	CLIP-seq
MIRT2205510	hsa-miR-125a-5p	CLIP-seq
MIRT2205511	hsa-miR-125b	CLIP-seq
MIRT2205512	hsa-miR-3163	CLIP-seq
MIRT2205513	hsa-miR-3166	CLIP-seq
MIRT2205514	hsa-miR-3616-3p	CLIP-seq
MIRT2205515	hsa-miR-4269	CLIP-seq
MIRT2205516	hsa-miR-4319	CLIP-seq
MIRT2205517	hsa-miR-4436b-3p	CLIP-seq
MIRT2205518	hsa-miR-4509	CLIP-seq
MIRT2205519	hsa-miR-4514	CLIP-seq
MIRT2205520	hsa-miR-4520b-3p	CLIP-seq
MIRT2205521	hsa-miR-4529-3p	CLIP-seq
MIRT2205522	hsa-miR-4535	CLIP-seq
MIRT2205523	hsa-miR-4668-3p	CLIP-seq
MIRT2205524	hsa-miR-4692	CLIP-seq
MIRT2205525	hsa-miR-4721	CLIP-seq
MIRT2205526	hsa-miR-4742-5p	CLIP-seq
MIRT2205527	hsa-miR-4747-5p	CLIP-seq
MIRT2205528	hsa-miR-4776-5p	CLIP-seq
MIRT2205529	hsa-miR-544b	CLIP-seq
MIRT2205530	hsa-miR-562	CLIP-seq
MIRT2205531	hsa-miR-711	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA	16236796
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	16236796
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007283	Process	Spermatogenesis	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035497	Function	CAMP response element binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16236796
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
607138	18854	ENSG00000143578

Protein

UniProt ID

Q8TEY5

Protein name

Cyclic AMP-responsive element-binding protein 3-like protein 4 (cAMP-responsive element-binding protein 3-like protein 4) (Androgen-induced basic leucine zipper protein) (AIbZIP) (Attaching to CRE-like 1) (ATCE1) (Cyclic AMP-responsive element-binding pro

Protein function

Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional acti

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	215 → 291	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: According to PubMed:11830526, exclusively expressed in the prostate. Expressed in breast and prostate cancer cell lines. Expressed in prostatic luminal epithelial cells (at protein level). Expression is significantly more abundant in p

Sequence

MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM

Sequence length

395

Interactions

View interactions

	KEGG
	cGMP-PKG signaling pathway cAMP signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Longevity regulating pathway Adrenergic signaling in cardiomyocytes TNF signaling pathway Thermogenesis Cholinergic synapse Dopaminergic synapse Insulin secretion Estrogen signaling pathway Melanogenesis Thyroid hormone synthesis Glucagon signaling pathway Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Insulin resistance Cushing syndrome Growth hormone synthesis, secretion and action Vasopressin-regulated water reabsorption Huntington disease Prion disease Cocaine addiction Amphetamine addiction Alcoholism Hepatitis B Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis Chemical carcinogenesis - receptor activation Prostate cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	27415467

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	30483806, 32705365
Depressive Disorder	Associate	19192256
Disease	Associate	19192256
Dwarfism Pituitary	Associate	34589056
Leukemia Lymphoma Adult T Cell	Associate	34446027
Lung Neoplasms	Stimulate	28056099
Paraparesis Tropical Spastic	Associate	34446027
Prostatic Neoplasms	Associate	27853318, 28338058

CREB3L4 (cAMP responsive element binding protein 3 like 4)