Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1471
Gene name Gene Name - the full gene name approved by the HGNC.	Cystatin C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CST3
Synonyms (NCBI Gene) Gene synonyms aliases	ADLDWA, ARMD11, HEL-S-2
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1064039	C>G,T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs28939068	A>T	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019152	hsa-miR-335-5p	Microarray	18185580
MIRT030271	hsa-miR-26b-5p	Microarray	19088304
MIRT618226	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT618225	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT618224	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT618223	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT618222	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT618221	hsa-miR-4303	HITS-CLIP	23824327
MIRT618220	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT618219	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT618218	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT618217	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT618216	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT618226	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT618225	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT618224	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT618223	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT618222	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT618221	hsa-miR-4303	HITS-CLIP	23824327
MIRT618220	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT618219	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT618218	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT618217	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT618216	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT618226	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT618225	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT618224	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT618223	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT618222	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT618221	hsa-miR-4303	HITS-CLIP	23824327
MIRT618220	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT618219	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT618218	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT618217	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT618216	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT618226	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT618225	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT618224	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT618223	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT618222	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT618221	hsa-miR-4303	HITS-CLIP	23824327
MIRT618220	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT618219	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT618218	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT618217	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT618216	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT618226	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT618225	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT618224	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT618223	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT618222	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT618221	hsa-miR-4303	HITS-CLIP	23824327
MIRT618220	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT618219	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT618218	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT618217	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT618216	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT618226	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT618225	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT618224	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT618223	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT618222	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT618221	hsa-miR-4303	HITS-CLIP	23824327
MIRT618220	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT618219	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT618218	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT618217	hsa-miR-4762-3p	HITS-CLIP	23824327
MIRT618216	hsa-miR-148a-5p	HITS-CLIP	23824327
MIRT913298	hsa-miR-1207-5p	CLIP-seq
MIRT913299	hsa-miR-1286	CLIP-seq
MIRT913300	hsa-miR-137	CLIP-seq
MIRT913301	hsa-miR-1909	CLIP-seq
MIRT913302	hsa-miR-1972	CLIP-seq
MIRT913303	hsa-miR-1976	CLIP-seq
MIRT913304	hsa-miR-2355-5p	CLIP-seq
MIRT913305	hsa-miR-25	CLIP-seq
MIRT913306	hsa-miR-3120-5p	CLIP-seq
MIRT913307	hsa-miR-3150a-3p	CLIP-seq
MIRT913308	hsa-miR-3175	CLIP-seq
MIRT913309	hsa-miR-3194-5p	CLIP-seq
MIRT913310	hsa-miR-32	CLIP-seq
MIRT913311	hsa-miR-3622a-5p	CLIP-seq
MIRT913312	hsa-miR-363	CLIP-seq
MIRT913313	hsa-miR-367	CLIP-seq
MIRT913314	hsa-miR-3689a-3p	CLIP-seq
MIRT913315	hsa-miR-3689c	CLIP-seq
MIRT913316	hsa-miR-3689d	CLIP-seq
MIRT913317	hsa-miR-3714	CLIP-seq
MIRT913318	hsa-miR-3940-3p	CLIP-seq
MIRT913319	hsa-miR-4269	CLIP-seq
MIRT913320	hsa-miR-4423-3p	CLIP-seq
MIRT913321	hsa-miR-4447	CLIP-seq
MIRT913322	hsa-miR-4459	CLIP-seq
MIRT913323	hsa-miR-4472	CLIP-seq
MIRT913324	hsa-miR-4489	CLIP-seq
MIRT913325	hsa-miR-4508	CLIP-seq
MIRT913326	hsa-miR-455-3p	CLIP-seq
MIRT913327	hsa-miR-4651	CLIP-seq
MIRT913328	hsa-miR-4655-5p	CLIP-seq
MIRT913329	hsa-miR-4685-5p	CLIP-seq
MIRT913330	hsa-miR-4717-3p	CLIP-seq
MIRT913331	hsa-miR-4722-5p	CLIP-seq
MIRT913332	hsa-miR-4728-5p	CLIP-seq
MIRT913333	hsa-miR-4763-3p	CLIP-seq
MIRT913334	hsa-miR-501-3p	CLIP-seq
MIRT913335	hsa-miR-502-3p	CLIP-seq
MIRT913336	hsa-miR-548q	CLIP-seq
MIRT913337	hsa-miR-608	CLIP-seq
MIRT913338	hsa-miR-769-5p	CLIP-seq
MIRT913339	hsa-miR-92a	CLIP-seq
MIRT913340	hsa-miR-92b	CLIP-seq
MIRT913341	hsa-miR-939	CLIP-seq
MIRT913342	hsa-miR-940	CLIP-seq
MIRT913303	hsa-miR-1976	CLIP-seq
MIRT913306	hsa-miR-3120-5p	CLIP-seq
MIRT1970861	hsa-miR-370	CLIP-seq
MIRT1970862	hsa-miR-4297	CLIP-seq
MIRT1970863	hsa-miR-942	CLIP-seq
MIRT913298	hsa-miR-1207-5p	CLIP-seq
MIRT913299	hsa-miR-1286	CLIP-seq
MIRT913300	hsa-miR-137	CLIP-seq
MIRT913301	hsa-miR-1909	CLIP-seq
MIRT913303	hsa-miR-1976	CLIP-seq
MIRT913304	hsa-miR-2355-5p	CLIP-seq
MIRT913305	hsa-miR-25	CLIP-seq
MIRT913306	hsa-miR-3120-5p	CLIP-seq
MIRT913307	hsa-miR-3150a-3p	CLIP-seq
MIRT913308	hsa-miR-3175	CLIP-seq
MIRT913310	hsa-miR-32	CLIP-seq
MIRT913312	hsa-miR-363	CLIP-seq
MIRT913313	hsa-miR-367	CLIP-seq
MIRT913316	hsa-miR-3689d	CLIP-seq
MIRT913317	hsa-miR-3714	CLIP-seq
MIRT913319	hsa-miR-4269	CLIP-seq
MIRT1970862	hsa-miR-4297	CLIP-seq
MIRT913321	hsa-miR-4447	CLIP-seq
MIRT913322	hsa-miR-4459	CLIP-seq
MIRT913323	hsa-miR-4472	CLIP-seq
MIRT913324	hsa-miR-4489	CLIP-seq
MIRT913325	hsa-miR-4508	CLIP-seq
MIRT913326	hsa-miR-455-3p	CLIP-seq
MIRT913328	hsa-miR-4655-5p	CLIP-seq
MIRT2206618	hsa-miR-4712-3p	CLIP-seq
MIRT913330	hsa-miR-4717-3p	CLIP-seq
MIRT913331	hsa-miR-4722-5p	CLIP-seq
MIRT913332	hsa-miR-4728-5p	CLIP-seq
MIRT913333	hsa-miR-4763-3p	CLIP-seq
MIRT913334	hsa-miR-501-3p	CLIP-seq
MIRT913335	hsa-miR-502-3p	CLIP-seq
MIRT913336	hsa-miR-548q	CLIP-seq
MIRT913338	hsa-miR-769-5p	CLIP-seq
MIRT913339	hsa-miR-92a	CLIP-seq
MIRT913340	hsa-miR-92b	CLIP-seq
MIRT913341	hsa-miR-939	CLIP-seq
MIRT913342	hsa-miR-940	CLIP-seq
MIRT1970863	hsa-miR-942	CLIP-seq
MIRT913314	hsa-miR-3689a-3p	CLIP-seq
MIRT913315	hsa-miR-3689c	CLIP-seq
MIRT913316	hsa-miR-3689d	CLIP-seq
MIRT913327	hsa-miR-4651	CLIP-seq
MIRT913329	hsa-miR-4685-5p	CLIP-seq
MIRT913332	hsa-miR-4728-5p	CLIP-seq
MIRT913337	hsa-miR-608	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IPI	18026102
GO:0002020	Function	Protease binding	IPI	6203523, 7890620
GO:0004866	Function	Endopeptidase inhibitor activity	IDA	15127951
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IBA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	3488317, 6203523, 7890620, 8999869
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	15127951, 17462596, 25630877, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IMP	18026102
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3488317, 18613859, 28904096
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	TAS	28904096
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA	15212960
GO:0005886	Component	Plasma membrane	IDA	22365146
GO:0006952	Process	Defense response	IDA	6203523
GO:0006955	Process	Immune response	TAS	18256700
GO:0010711	Process	Negative regulation of collagen catabolic process	IMP	10545518
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IDA	7890620
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IMP	10545518
GO:0030414	Function	Peptidase inhibitor activity	IDA	18256700
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031982	Component	Vesicle	IBA
GO:0034103	Process	Regulation of tissue remodeling	IMP	10545518
GO:0042802	Function	Identical protein binding	IPI	25479090, 26865059
GO:0045861	Process	Negative regulation of proteolysis	IDA	3488317, 6203523
GO:0060311	Process	Negative regulation of elastin catabolic process	IMP	10545518
GO:0060313	Process	Negative regulation of blood vessel remodeling	IMP	10545518
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0097435	Process	Supramolecular fiber organization	IMP	18026102
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
604312	2475	ENSG00000101439

Protein

UniProt ID

P01034

Protein name

Cystatin-C (Cystatin-3) (Gamma-trace) (Neuroendocrine basic polypeptide) (Post-gamma-globulin)

Protein function

As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

PDB

1G96 , 1R4C , 1TIJ , 3GAX , 3NX0 , 3PS8 , 3QRD , 3S67 , 3SVA , 6ROA , 6RPV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00031	Cystatin	37 → 132	Cystatin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, b

Sequence

MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA

Sequence length

146

Interactions

View interactions

	KEGG		Reactome
	Salivary secretion		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Neutrophil degranulation Post-translational protein phosphorylation Amyloid fiber formation

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hereditary Cerebral Amyloid Angiopathy	hereditary cerebral amyloid angiopathy, icelandic type	rs28939068	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (160)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	28487367, 28554490, 3322021, 3495457, 8108423, 8576118, 8579098
Acute Kidney Injury	Associate	20522534, 20827258, 24409073, 25944130, 28640195, 35891358, 36565177
Acute Kidney Injury	Stimulate	20538834, 22418979, 23317940
Acute On Chronic Liver Failure	Associate	24409073
Adenocarcinoma	Associate	37002266
Alzheimer Disease	Associate	11549598, 12016588, 12787072, 19917302, 23735279, 25893795, 26409164, 26845025, 27845782, 28554490, 29046353, 34551193, 36899848
Alzheimer Disease	Stimulate	15907478, 34551193
Alzheimer Disease	Inhibit	18824671, 19584436
Amyloid angiopathy	Associate	15028721
Amyloidosis	Associate	2541223, 29455155, 3495457, 3517880, 3707586
Amyloidosis Familial	Associate	11849445, 29455155
Amyotrophic Lateral Sclerosis	Associate	16313519
Amyotrophic Lateral Sclerosis	Inhibit	20583124, 21151566
Anemia Sickle Cell	Associate	38353026
Aneurysm	Associate	14716800
Anterior Wall Myocardial Infarction	Associate	14716800
Aortic Aneurysm Abdominal	Associate	14716800, 17322367, 18155003, 22804761, 24833013
Aortic Aneurysm Familial Abdominal 1	Associate	14716800, 18155003
Aortic Aneurysm Familial Abdominal 1	Inhibit	17322367
Aortic Valve Stenosis	Associate	36226463
Arthritis Juvenile	Associate	35033099
Atherosclerosis	Associate	20690093, 27353608, 29090609
Brain Infarction	Stimulate	25213770
Brain Ischemia	Associate	21415918
Breast Neoplasms	Inhibit	26757339
Breast Neoplasms	Associate	27592448, 33172965
Bronchiolitis Obliterans Syndrome	Associate	35876129
Carcinogenesis	Associate	26757339
Carcinoma Hepatocellular	Inhibit	31115549
Carcinoma Hepatocellular	Associate	38134103
Carcinoma Renal Cell	Associate	30257338
Carcinoma Squamous Cell	Associate	37841237
Cardiovascular Diseases	Associate	18940290, 19151417, 21415918, 23932088, 24392614, 26057752, 27353608, 27561768, 29090609, 34774109
Cardiovascular Diseases	Stimulate	37817071
Cerebral Amyloid Angiopathy	Associate	28067897, 31330077
Cerebral Amyloid Angiopathy Familial	Associate	1979681, 2541223, 28067897, 28487367, 33758187, 3495457, 3517880, 8108423, 9445375
Cerebral Hemorrhage	Associate	2541223, 28067897, 31330077
Cerebral Infarction	Associate	37944982
Chronic Kidney Disease Mineral and Bone Disorder	Associate	24918752
Cognition Disorders	Associate	25609760
Colorectal Neoplasms	Stimulate	39940785
Communicable Diseases	Associate	38310908
Coronary Artery Disease	Associate	20690093, 22978689, 26057752, 28189145, 32481372
Coronary Artery Disease	Stimulate	37817071
Coronary Disease	Associate	19816865, 32481372, 35800677
COVID 19	Associate	36124564, 38310908
Craniosynostoses	Stimulate	32184430
Cushing's symphalangism	Stimulate	32481372
Death	Associate	15028721, 22117908
Death Sudden Cardiac	Associate	20233980
Dementia	Associate	31330077, 33758187, 8579098
Dental Plaque	Associate	27010456, 35535576, 37817071
Depressive Disorder Major	Stimulate	27232630
Diabetes Mellitus	Stimulate	27809845, 32306911, 37002266
Diabetes Mellitus	Associate	37452735
Diabetes Mellitus Type 2	Associate	19151417, 29090609, 32306911, 37002266
Diabetic Nephropathies	Associate	33811534, 34964177, 36482996
Diastrophic dysplasia	Stimulate	37002266
Diffuse Cerebral Sclerosis of Schilder	Stimulate	25213770
Diffuse Neurofibrillary Tangles with Calcification	Associate	11549598
Disease	Associate	32306911
Down Syndrome	Associate	28554490
Drug Related Side Effects and Adverse Reactions	Inhibit	26409164
Dyslipidemias	Associate	35945262
Encephalitis	Associate	26092112
Esophageal Neoplasms	Associate	26617717, 28423738
Essential Hypertension	Stimulate	32481372
Extravasation of Diagnostic and Therapeutic Materials	Stimulate	34260518
Fabry Disease	Associate	40420032
Fatigue Syndrome Chronic	Associate	24088505
Fibrosis	Associate	24790080, 33811534
Frontotemporal Dementia	Associate	30292090
Gastrointestinal Neoplasms	Associate	38263244
Genetic Diseases Inborn	Associate	2541223
Glycogen Storage Disease Type II	Associate	15479453
Glycosuria Renal	Associate	12519404, 39617478
Graves Disease	Stimulate	20926009
Guillain Barre Syndrome	Associate	18343991
Headache Disorders Secondary	Associate	26272683
Heart Failure	Associate	22117908, 27561768, 34774109, 35945262, 37798313
Heart Failure Systolic	Associate	22117908
Hepatitis C Chronic	Associate	22947524
HIV Infections	Associate	26092112, 34867965
HIV Seropositivity	Associate	23291538
Hypertension	Stimulate	18940290
Hypertension	Associate	27876431, 32481372, 32857720
Hyperthyroidism	Stimulate	20926009
Hypoxia	Inhibit	16080536
Infarction	Associate	33758187
Infections	Stimulate	21541353
Inflammation	Associate	22117908, 26426044, 32170118, 35876129, 36226463, 38112943
Inflammatory Breast Neoplasms	Associate	18949742
Intervertebral Disc Degeneration	Associate	28652204
Intracranial Hemorrhages	Associate	15028721, 8576118
Ischemia	Associate	19816865, 32704130
Kidney Diseases	Associate	20233980, 22978689, 25213770, 27010456, 31959411, 34260518, 34938273, 35945262, 36565177, 37586323
Leukemia	Associate	26716897
Leukemia Lymphocytic Chronic B Cell	Inhibit	21496199
Leukoencephalopathies	Stimulate	25213770
Leukoencephalopathies	Associate	32170118
Lewy Body Disease	Associate	26627638
Liver Failure	Associate	22947524
Macular Degeneration	Associate	11815350, 15479453, 19917302, 25893795, 26865059, 32049341, 36899848
Melanoma	Associate	28630039
Melanoma	Inhibit	33837649
Meningioma	Associate	15832773
Mental Disorders	Associate	19360013
Metabolic Syndrome	Associate	21415918, 27218257
Minicore Myopathy with External Ophthalmoplegia	Associate	32306911
Multiple Myeloma	Associate	37522196
Multiple Organ Failure	Stimulate	39511501
Multiple Sclerosis	Associate	19602050, 35049167
Mycobacterium Infections Nontuberculous	Associate	34867965
Myocardial Infarction	Associate	22664813, 27353608
Myositis Inclusion Body	Associate	12787072
Neoplasm Metastasis	Associate	18949742
Neoplasm Metastasis	Inhibit	23629651
Neoplasms	Associate	10913110, 15138478, 18949742, 23629651, 28630039, 30257338, 36658726, 40312330
Neoplasms	Inhibit	19956729, 26617717, 33172965
Nerve Degeneration	Associate	11549598
Neurotoxicity Syndromes	Associate	22693552
Obesity	Stimulate	19360013
Obesity	Associate	21577020, 35945262
Pain	Associate	35033099
Paralysis	Associate	33758187
Parkinson Disease	Associate	26367713, 34528139
Pelvic Inflammatory Disease	Associate	18314113
Peripheral Arterial Disease	Associate	18687758
Periventricular Nodular Heterotopia	Associate	32170118
Plaque Amyloid	Associate	2541223, 33758187
Porphyria Acute Hepatic	Associate	35876129
Post Acute COVID 19 Syndrome	Associate	38112943
Pre Eclampsia	Associate	36213583
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16029452, 16644881
Prostatic Neoplasms	Inhibit	19956729
Prostatic Neoplasms	Associate	23629651
Pterygium	Associate	23442876
Pulmonary Disease Chronic Obstructive	Associate	23900981
Pulmonary edema of mountaineers	Associate	40640242
Renal cysts and diabetes syndrome	Associate	19151417
Renal Insufficiency	Associate	37002266
Renal Insufficiency Chronic	Associate	18940290, 23932088, 28549536, 32857720, 36926036, 40000571
Renal Tubular Transport Inborn Errors	Associate	33811534
Retinal Perforations	Associate	37530283
Rupture	Inhibit	17322367
Schizophrenia	Associate	28974776, 37060872
Spinal Cord Injuries	Associate	37446303
Squamous Cell Carcinoma of Head and Neck	Associate	15138478
ST Elevation Myocardial Infarction	Associate	30907012
Stiff Skin Syndrome	Associate	24392614
Stomatitis Denture	Associate	23041753, 24947908
Stroke	Associate	2541223, 27353608, 31330077, 33462484, 8579098
Syndrome	Associate	36565177
Tuberculosis	Associate	34867965
Tuberculosis Multidrug Resistant	Associate	34867965
Uveal melanoma	Associate	19273215
Vaginosis Bacterial	Associate	26081632
Venous Thromboembolism	Stimulate	39617478
Ventricular Fibrillation	Associate	15028721
Weight Loss	Associate	35945262

CST3 (cystatin C)