CST2 (cystatin SA)

Gene

• Entrez ID: 1470
• Gene name: Cystatin SA
• Gene symbol: CST2
• Synonyms (NCBI Gene): -
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018818	hsa-miR-335-5p	Microarray	18185580
MIRT030133	hsa-miR-26b-5p	Microarray	19088304
MIRT913282	hsa-miR-1253	CLIP-seq
MIRT913283	hsa-miR-1321	CLIP-seq
MIRT913284	hsa-miR-3173-3p	CLIP-seq
MIRT913285	hsa-miR-331-3p	CLIP-seq
MIRT913286	hsa-miR-3616-3p	CLIP-seq
MIRT913287	hsa-miR-4419a	CLIP-seq
MIRT913288	hsa-miR-4436b-3p	CLIP-seq
MIRT913289	hsa-miR-4510	CLIP-seq
MIRT913290	hsa-miR-4533	CLIP-seq
MIRT913291	hsa-miR-4685-5p	CLIP-seq
MIRT913292	hsa-miR-4712-3p	CLIP-seq
MIRT913293	hsa-miR-4728-5p	CLIP-seq
MIRT913294	hsa-miR-4739	CLIP-seq
MIRT913295	hsa-miR-4756-5p	CLIP-seq
MIRT913296	hsa-miR-4779	CLIP-seq
MIRT913297	hsa-miR-548p	CLIP-seq
MIRT2206616	hsa-miR-4447	CLIP-seq
MIRT2206617	hsa-miR-4472	CLIP-seq
MIRT913291	hsa-miR-4685-5p	CLIP-seq
MIRT2509961	hsa-miR-3936	CLIP-seq
MIRT2509962	hsa-miR-4266	CLIP-seq
MIRT2509963	hsa-miR-4651	CLIP-seq
MIRT2509964	hsa-miR-4695-5p	CLIP-seq
MIRT913296	hsa-miR-4779	CLIP-seq
MIRT2509965	hsa-miR-608	CLIP-seq
MIRT2509966	hsa-miR-624	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA

Other IDs

• MIM: 123856
• HGNC: 2474
• e!Ensembl: ENSG00000170369

Protein

• UniProt ID: P09228
• Protein name: Cystatin-SA (Cystatin-2) (Cystatin-S5)
• Protein function: Thiol protease inhibitor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00031	Cystatin	32 → 127	Cystatin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in submandibular gland and parotid gland. {ECO:0000269|PubMed:11879580, ECO:0000269|PubMed:20189825}.
• Sequence:

  MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATE
  DEYYRRLLRVLRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
  QIYEVPWEDRMSLVNSRCQEA

• Sequence length: 141

Pathways

KEGG:

Salivary secretion

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Myocardial infarction	Myocardial Infarction		21211798	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
Allergic Fungal Sinusitis	Associate	39911041
Asthma	Stimulate	28933920
Breast Neoplasms	Associate	31182966
Carcinoma Hepatocellular	Associate	31115549
Keratoconus	Associate	21701529
Lichen Planus Oral	Inhibit	29534707
Microsatellite Instability	Associate	39926600
Neoplasm Metastasis	Associate	39926600
Neoplasms	Associate	39926600
Phobic Disorders	Associate	36776870
Prostatic Neoplasms	Associate	31376183, 34777331
Respiratory Sounds	Associate	36776870
Stomach Neoplasms	Associate	36044785, 37061682, 39926600
Vaginosis Bacterial	Associate	26081632