KIF18B (kinesin family member 18B)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
146909
Gene name Gene Name - the full gene name approved by the HGNC.
Kinesin family member 18B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KIF18B
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.31
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(52)
miRTarBase ID miRNA Experiments Reference
MIRT049401 hsa-miR-92a-3p CLASH 23622248
MIRT048234 hsa-miR-196a-5p CLASH 23622248
MIRT672728 hsa-miR-5693 HITS-CLIP 23824327
MIRT672727 hsa-miR-6499-5p HITS-CLIP 23824327
MIRT672726 hsa-miR-6089 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(40)
GO ID Ontology Definition Evidence Reference
GO:0000070 Process Mitotic sister chromatid segregation IBA
GO:0000166 Function Nucleotide binding IEA
GO:0000235 Component Astral microtubule IDA 21820309
GO:0000278 Process Mitotic cell cycle IDA 20600703
GO:0000278 Process Mitotic cell cycle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
614570 27102 ENSG00000186185
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q86Y91
Protein name Kinesin-like protein KIF18B
Protein function In complex with KIF2C, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells. Its major role may be to transport KIF2C and/or MAPRE1 along microtubules.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00225 Kinesin 13 → 351 Kinesin motor domain Domain
Tissue specificity TISSUE SPECIFICITY: Shows a prominent expression in the amygdala. {ECO:0000269|PubMed:20600703}.
Sequence 
MAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDG
PKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTML
GREGDPGIMYLTTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGPLAIREDPD
KGVVVQGLSFHQPASAEQLLEILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPG
LTQAVQVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKTH
VPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLSLKSNVT
SLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPPQDLPGSPKSGPPPEHQPCTPEL
PAGPRALQEESLGMEAQVERAMEGNSSDQEQSPEDEDEGPAEEVPTQMPEQNPTHALPES
PRLTLQPKPVVGHFSARELDGDRSKQLALKVLCVAQRQYSLLQAANLLTPDMITEFETLQ
QLVQEEKIEPGAEALRTSGLARGAPLAQELCSESIPVPSPLCPEPPGYTGPVTRTMARRL
SGPLHTLGIPPGPNCTPAQGSRWPMEKKRRRPSALEADSPMAPKRGTKRQRQSFLPCLRR
GSLPDTQPSQGPSTPKGERASSPCHSPRVCPATVIKSRVPLGPSAMQNCSTPLALPTRDL
NATFDLSEEPPSKPSFHECIGWDKIPQELSRLDQPFIPRAPVPLFTMKGPKPTSSLPGTS
ACKKKRVASSSVSHGRSRIARLPSSTLKRPAGPLVLPELPLSPLCPSNRRNGKDLIRVGR
ALSAGNGVTKVS
Sequence length 852
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Motor proteins   COPI-dependent Golgi-to-ER retrograde traffic
Kinesins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer (early onset) N/A N/A GWAS
Show/Hide Text Mining Associations (24)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31322267, 36499051
Adenomatous Polyposis Coli Associate 32587775
Bone Diseases Metabolic Associate 32963334
Breast Neoplasms Associate 31758680
Carcinogenesis Associate 25236463
Carcinoma Hepatocellular Associate 25236463, 31011256, 34112092
Carcinoma Renal Cell Stimulate 31489573
Carcinoma Renal Cell Associate 31746384
Carcinoma Squamous Cell Associate 36499051
Esophageal Neoplasms Stimulate 36085568