Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	146722
Gene name	CD300 molecule like family member f
Gene symbol	CD300LF
Synonyms (NCBI Gene)	CD300fCLM-1CLM1IREM-1IREM1IgSF13LMIR3NKIR
Chromosome	17
Chromosome location	17q25.1
Summary	This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments
MIRT874949	hsa-miR-1299	CLIP-seq
MIRT874950	hsa-miR-132	CLIP-seq
MIRT874951	hsa-miR-194	CLIP-seq
MIRT874952	hsa-miR-204	CLIP-seq
MIRT874953	hsa-miR-211	CLIP-seq
MIRT874954	hsa-miR-212	CLIP-seq
MIRT874955	hsa-miR-28-5p	CLIP-seq
MIRT874956	hsa-miR-3128	CLIP-seq
MIRT874957	hsa-miR-3130-3p	CLIP-seq
MIRT874958	hsa-miR-3139	CLIP-seq
MIRT874959	hsa-miR-3612	CLIP-seq
MIRT874960	hsa-miR-3670	CLIP-seq
MIRT874961	hsa-miR-4443	CLIP-seq
MIRT874962	hsa-miR-4446-5p	CLIP-seq
MIRT874963	hsa-miR-4704-3p	CLIP-seq
MIRT874964	hsa-miR-4720-5p	CLIP-seq
MIRT874965	hsa-miR-4727-5p	CLIP-seq
MIRT874966	hsa-miR-4755-5p	CLIP-seq
MIRT874967	hsa-miR-4769-3p	CLIP-seq
MIRT874968	hsa-miR-4782-5p	CLIP-seq
MIRT874969	hsa-miR-4793-3p	CLIP-seq
MIRT874970	hsa-miR-4799-3p	CLIP-seq
MIRT874971	hsa-miR-513a-5p	CLIP-seq
MIRT874972	hsa-miR-516b	CLIP-seq
MIRT874973	hsa-miR-544	CLIP-seq
MIRT874974	hsa-miR-548ag	CLIP-seq
MIRT874975	hsa-miR-548ai	CLIP-seq
MIRT874976	hsa-miR-623	CLIP-seq
MIRT874977	hsa-miR-650	CLIP-seq
MIRT874978	hsa-miR-665	CLIP-seq
MIRT874979	hsa-miR-708	CLIP-seq
MIRT874952	hsa-miR-204	CLIP-seq
MIRT874953	hsa-miR-211	CLIP-seq
MIRT874957	hsa-miR-3130-3p	CLIP-seq
MIRT874965	hsa-miR-4727-5p	CLIP-seq
MIRT874967	hsa-miR-4769-3p	CLIP-seq
MIRT874969	hsa-miR-4793-3p	CLIP-seq
MIRT874973	hsa-miR-544	CLIP-seq
MIRT2196427	hsa-miR-1207-5p	CLIP-seq
MIRT2196428	hsa-miR-4446-3p	CLIP-seq
MIRT2196429	hsa-miR-4492	CLIP-seq
MIRT2196430	hsa-miR-4498	CLIP-seq
MIRT2196431	hsa-miR-4528	CLIP-seq
MIRT2196432	hsa-miR-4763-3p	CLIP-seq
MIRT2196433	hsa-miR-762	CLIP-seq
MIRT2196427	hsa-miR-1207-5p	CLIP-seq
MIRT2385739	hsa-miR-1909	CLIP-seq
MIRT2196428	hsa-miR-4446-3p	CLIP-seq
MIRT2196429	hsa-miR-4492	CLIP-seq
MIRT2196430	hsa-miR-4498	CLIP-seq
MIRT2196432	hsa-miR-4763-3p	CLIP-seq
MIRT2385740	hsa-miR-486-3p	CLIP-seq
MIRT2196433	hsa-miR-762	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002757	Process	Immune response-activating signaling pathway	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005136	Function	Interleukin-4 receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	20959446, 29051512, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IDA	24035150
GO:0034125	Process	Negative regulation of MyD88-dependent toll-like receptor signaling pathway	IMP	22043923
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IMP	22043923
GO:0035772	Process	Interleukin-13-mediated signaling pathway	ISS
GO:0042802	Function	Identical protein binding	IPI	20959446, 22291008, 29051512
GO:0097001	Function	Ceramide binding	IDA	24035150
GO:1902216	Process	Positive regulation of interleukin-4-mediated signaling pathway	ISS
GO:2000426	Process	Negative regulation of apoptotic cell clearance	ISS
GO:2000427	Process	Positive regulation of apoptotic cell clearance	ISS

MIM	HGNC	e!Ensembl
609807	29883	ENSG00000186074

Q8TDQ1

Protein name

CMRF35-like molecule 1 (CLM-1) (CD300 antigen-like family member F) (Immune receptor expressed on myeloid cells 1) (IREM-1) (Immunoglobulin superfamily member 13) (IgSF13) (NK inhibitory receptor) (CD antigen CD300f)

Protein function

Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731). Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is exp

PDB

2NMS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	23 → 126	Immunoglobulin V-set domain	Domain
PF15330	SIT	157 → 259		Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed s

Sequence

MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWR
DCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVT
VQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRM
MKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMA
SLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP

Sequence length

290

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

CD300LF (CD300 molecule like family member f)