Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	146433
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 34
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL34
Synonyms (NCBI Gene) Gene synonyms aliases	C16orf77, IL-34
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008]

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments
MIRT1064913	hsa-miR-1908	CLIP-seq
MIRT1064914	hsa-miR-3065-3p	CLIP-seq
MIRT1064915	hsa-miR-3616-3p	CLIP-seq
MIRT1064916	hsa-miR-4436b-3p	CLIP-seq
MIRT1064917	hsa-miR-4721	CLIP-seq
MIRT1064918	hsa-miR-663	CLIP-seq
MIRT1064919	hsa-miR-1224-3p	CLIP-seq
MIRT1064920	hsa-miR-1260	CLIP-seq
MIRT1064921	hsa-miR-1260b	CLIP-seq
MIRT1064922	hsa-miR-1280	CLIP-seq
MIRT1064923	hsa-miR-4283	CLIP-seq
MIRT1064924	hsa-miR-4780	CLIP-seq
MIRT1064925	hsa-miR-532-3p	CLIP-seq
MIRT2451772	hsa-miR-29a	CLIP-seq
MIRT2451773	hsa-miR-29b	CLIP-seq
MIRT2451774	hsa-miR-29c	CLIP-seq
MIRT2451775	hsa-miR-3139	CLIP-seq
MIRT2451776	hsa-miR-4434	CLIP-seq
MIRT2451777	hsa-miR-4516	CLIP-seq
MIRT2451778	hsa-miR-4733-3p	CLIP-seq
MIRT2451779	hsa-miR-4768-3p	CLIP-seq
MIRT2451780	hsa-miR-4786-3p	CLIP-seq
MIRT2451781	hsa-miR-665	CLIP-seq
MIRT2451782	hsa-miR-708	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18467591
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	IBA	21873635
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	IDA	18467591
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	18467591
GO:0006954	Process	Inflammatory response	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	18467591
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IDA	26754294
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	26754294
GO:0045087	Process	Innate immune response	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IBA	21873635
GO:0045651	Process	Positive regulation of macrophage differentiation	IDA	23409120
GO:0045657	Process	Positive regulation of monocyte differentiation	IBA	21873635
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	23409120
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0061098	Process	Positive regulation of protein tyrosine kinase activity	IDA	26754294
GO:0061514	Process	Interleukin-34-mediated signaling pathway	IDA	26754294
GO:0061518	Process	Microglial cell proliferation	IEA
GO:0120041	Process	Positive regulation of macrophage proliferation	IDA	26754294

MIM	HGNC	e!Ensembl
612081	28529	ENSG00000157368

Protein

UniProt ID

Q6ZMJ4

Protein name

Interleukin-34 (IL-34)

Protein function

Cytokine that promotes the proliferation, survival and differentiation of monocytes and macrophages. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays

PDB

4DKC , 4DKD , 4DKE , 4DKF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15036	IL34	28 → 184	Interleukin 34	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small

Sequence

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPI
NYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ
EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCC
KQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGL
LP

Sequence length

242

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor		Other interleukin signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	29274321

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	28816551, 35589863
Arthritis Rheumatoid	Associate	22039170, 22264405, 28659662, 30033738, 30538782, 31498070, 32264938, 33335239, 34385542
Brain Injuries	Associate	28816551
Carcinogenesis	Associate	31621133
Carcinoma Hepatocellular	Associate	31621133
Colorectal Neoplasms	Associate	31762401
Dermatitis Atopic	Associate	31596431
Diabetic Nephropathies	Associate	25359423
Eczema	Associate	31596431
Esophageal Squamous Cell Carcinoma	Associate	33674443
Hepatitis B	Associate	31621133
Hepatoblastoma	Associate	35132816
IgA Vasculitis	Associate	28659662, 31498070
Inflammation	Associate	23392590, 33550830
Inflammatory Bowel Diseases	Associate	27898738
Leukemia Lymphoma Adult T Cell	Associate	30541986
Lung Neoplasms	Associate	29323162
Lupus Nephritis	Associate	31298388
Mesothelioma Malignant	Associate	32581053
Neoplasms	Associate	29323162, 30580386, 31762401, 33674443, 35132816, 37761972
Nerve Degeneration	Associate	33550830
Neurodegenerative Diseases	Associate	28816551
Neuroma Acoustic	Associate	30580386
Non Muscle Invasive Bladder Neoplasms	Associate	33465047
Osteoarthritis	Associate	30159102
Osteoarthritis Knee	Associate	30159102, 32409720
Osteoarthritis Knee	Stimulate	33550830
Peritonitis	Stimulate	23392590
Pre Eclampsia	Associate	29579271
Pruritus	Associate	31596431
Sialadenitis	Associate	23392590
Sjogren's Syndrome	Stimulate	23392590
Squamous Cell Carcinoma of Head and Neck	Associate	34201353
Synovial Cyst	Associate	33550830
Synovitis	Associate	22039170, 32409720
Thyroid Cancer Papillary	Stimulate	32573824
Tooth Erosion	Associate	22039170
Triple Negative Breast Neoplasms	Associate	35377948
Urinary Bladder Neoplasms	Associate	34329197

IL34 (interleukin 34)