Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
146330
Gene name Gene Name - the full gene name approved by the HGNC.
F-box and leucine rich repeat protein 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXL16
Synonyms (NCBI Gene) Gene synonyms aliases
C16orf22, Fbl16, c380A1.1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045637 hsa-miR-149-5p CLASH 23622248
MIRT038481 hsa-miR-296-3p CLASH 23622248
MIRT038481 hsa-miR-296-3p CLASH 23622248
MIRT045637 hsa-miR-149-5p HITS-CLIP 23824327
MIRT623964 hsa-miR-421 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 34818544
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0019005 Component SCF ubiquitin ligase complex IBA
GO:0031146 Process SCF-dependent proteasomal ubiquitin-dependent protein catabolic process IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609082 14150 ENSG00000127585
Protein
UniProt ID Q8N461
Protein name F-box/LRR-repeat protein 16 (F-box and leucine-rich repeat protein 16)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13516 LRR_6 318 342 Leucine Rich repeat Repeat
PF13516 LRR_6 344 368 Leucine Rich repeat Repeat
Sequence
MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSL
AAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQV
CKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLD
ICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSL
SARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLR
LLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRIT
DMALEYVA
CDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLA
LGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Sequence length 479
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Endometrial Neoplasms Associate 36106050