Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	145957
Gene name Gene Name - the full gene name approved by the HGNC.	Neuregulin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NRG4
Synonyms (NCBI Gene) Gene synonyms aliases	HRG4
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation (Harari et al., 1999 [PubMed 10348342]).[supplied by OMIM, Mar 2008]

Show/Hide all(143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024936	hsa-miR-215-5p	Microarray	19074876
MIRT026870	hsa-miR-192-5p	Microarray	19074876
MIRT454404	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT454403	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT454402	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT454400	hsa-miR-1321	PAR-CLIP	23592263
MIRT454401	hsa-miR-4739	PAR-CLIP	23592263
MIRT454399	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT454398	hsa-miR-5693	PAR-CLIP	23592263
MIRT454397	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT454396	hsa-miR-4419a	PAR-CLIP	23592263
MIRT454395	hsa-miR-4510	PAR-CLIP	23592263
MIRT454394	hsa-miR-6127	PAR-CLIP	23592263
MIRT454393	hsa-miR-6129	PAR-CLIP	23592263
MIRT454392	hsa-miR-6130	PAR-CLIP	23592263
MIRT454391	hsa-miR-6133	PAR-CLIP	23592263
MIRT454390	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT454388	hsa-miR-5194	PAR-CLIP	23592263
MIRT454389	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT454387	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT454386	hsa-miR-4306	PAR-CLIP	23592263
MIRT454385	hsa-miR-4644	PAR-CLIP	23592263
MIRT454384	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT454383	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT454382	hsa-miR-8085	PAR-CLIP	23592263
MIRT454381	hsa-miR-6881-5p	PAR-CLIP	23592263
MIRT454380	hsa-miR-4276	PAR-CLIP	23592263
MIRT454379	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT454378	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT454377	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT454404	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT454403	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT454402	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT454400	hsa-miR-1321	PAR-CLIP	23592263
MIRT454401	hsa-miR-4739	PAR-CLIP	23592263
MIRT454399	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT454398	hsa-miR-5693	PAR-CLIP	23592263
MIRT454397	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT454396	hsa-miR-4419a	PAR-CLIP	23592263
MIRT454395	hsa-miR-4510	PAR-CLIP	23592263
MIRT454394	hsa-miR-6127	PAR-CLIP	23592263
MIRT454393	hsa-miR-6129	PAR-CLIP	23592263
MIRT454392	hsa-miR-6130	PAR-CLIP	23592263
MIRT454391	hsa-miR-6133	PAR-CLIP	23592263
MIRT454390	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT454388	hsa-miR-5194	PAR-CLIP	23592263
MIRT454389	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT454387	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT454386	hsa-miR-4306	PAR-CLIP	23592263
MIRT454385	hsa-miR-4644	PAR-CLIP	23592263
MIRT454384	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT454383	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT454382	hsa-miR-8085	PAR-CLIP	23592263
MIRT454381	hsa-miR-6881-5p	PAR-CLIP	23592263
MIRT454380	hsa-miR-4276	PAR-CLIP	23592263
MIRT454379	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT454378	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT454377	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1193951	hsa-miR-137	CLIP-seq
MIRT1193952	hsa-miR-27a	CLIP-seq
MIRT1193953	hsa-miR-27b	CLIP-seq
MIRT1193954	hsa-miR-3121-5p	CLIP-seq
MIRT1193955	hsa-miR-3123	CLIP-seq
MIRT1193956	hsa-miR-362-5p	CLIP-seq
MIRT1193957	hsa-miR-3925-5p	CLIP-seq
MIRT1193958	hsa-miR-4452	CLIP-seq
MIRT1193959	hsa-miR-4474-5p	CLIP-seq
MIRT1193960	hsa-miR-4494	CLIP-seq
MIRT1193961	hsa-miR-4639-5p	CLIP-seq
MIRT1193962	hsa-miR-4640-5p	CLIP-seq
MIRT1193963	hsa-miR-4659a-3p	CLIP-seq
MIRT1193964	hsa-miR-4659b-3p	CLIP-seq
MIRT1193965	hsa-miR-4670-3p	CLIP-seq
MIRT1193966	hsa-miR-4726-5p	CLIP-seq
MIRT1193967	hsa-miR-4732-5p	CLIP-seq
MIRT1193968	hsa-miR-4786-3p	CLIP-seq
MIRT1193969	hsa-miR-500b	CLIP-seq
MIRT1193970	hsa-miR-513a-5p	CLIP-seq
MIRT1193971	hsa-miR-629	CLIP-seq
MIRT1193972	hsa-miR-892a	CLIP-seq
MIRT2056239	hsa-miR-3661	CLIP-seq
MIRT2056240	hsa-miR-631	CLIP-seq
MIRT2056241	hsa-miR-758	CLIP-seq
MIRT2455456	hsa-miR-3065-5p	CLIP-seq
MIRT2455457	hsa-miR-3617	CLIP-seq
MIRT2455458	hsa-miR-4668-3p	CLIP-seq
MIRT2455459	hsa-miR-548u	CLIP-seq
MIRT2455460	hsa-miR-641	CLIP-seq
MIRT2582614	hsa-miR-1299	CLIP-seq
MIRT2582615	hsa-miR-3613-3p	CLIP-seq
MIRT2582616	hsa-miR-3672	CLIP-seq
MIRT2582617	hsa-miR-371-5p	CLIP-seq
MIRT2582618	hsa-miR-371b-5p	CLIP-seq
MIRT2582619	hsa-miR-4434	CLIP-seq
MIRT2582620	hsa-miR-4516	CLIP-seq
MIRT2582621	hsa-miR-4531	CLIP-seq
MIRT2582622	hsa-miR-4728-5p	CLIP-seq
MIRT2582623	hsa-miR-4782-5p	CLIP-seq
MIRT2582624	hsa-miR-4802-3p	CLIP-seq
MIRT2582625	hsa-miR-516b	CLIP-seq
MIRT2582626	hsa-miR-548a-5p	CLIP-seq
MIRT2582627	hsa-miR-548ab	CLIP-seq
MIRT2582628	hsa-miR-548ak	CLIP-seq
MIRT2582629	hsa-miR-548b-5p	CLIP-seq
MIRT2582630	hsa-miR-548c-5p	CLIP-seq
MIRT2582631	hsa-miR-548d-5p	CLIP-seq
MIRT2582632	hsa-miR-548h	CLIP-seq
MIRT2582633	hsa-miR-548i	CLIP-seq
MIRT2582634	hsa-miR-548j	CLIP-seq
MIRT2582635	hsa-miR-548k	CLIP-seq
MIRT2582636	hsa-miR-548l	CLIP-seq
MIRT2582637	hsa-miR-548n	CLIP-seq
MIRT2455459	hsa-miR-548u	CLIP-seq
MIRT2582638	hsa-miR-548w	CLIP-seq
MIRT2582639	hsa-miR-548y	CLIP-seq
MIRT2582640	hsa-miR-559	CLIP-seq
MIRT2582614	hsa-miR-1299	CLIP-seq
MIRT2582615	hsa-miR-3613-3p	CLIP-seq
MIRT2582616	hsa-miR-3672	CLIP-seq
MIRT2582617	hsa-miR-371-5p	CLIP-seq
MIRT2582618	hsa-miR-371b-5p	CLIP-seq
MIRT2582619	hsa-miR-4434	CLIP-seq
MIRT2582620	hsa-miR-4516	CLIP-seq
MIRT2582621	hsa-miR-4531	CLIP-seq
MIRT2582622	hsa-miR-4728-5p	CLIP-seq
MIRT2582623	hsa-miR-4782-5p	CLIP-seq
MIRT2582624	hsa-miR-4802-3p	CLIP-seq
MIRT2582625	hsa-miR-516b	CLIP-seq
MIRT2582626	hsa-miR-548a-5p	CLIP-seq
MIRT2582627	hsa-miR-548ab	CLIP-seq
MIRT2582628	hsa-miR-548ak	CLIP-seq
MIRT2582629	hsa-miR-548b-5p	CLIP-seq
MIRT2582630	hsa-miR-548c-5p	CLIP-seq
MIRT2582631	hsa-miR-548d-5p	CLIP-seq
MIRT2582632	hsa-miR-548h	CLIP-seq
MIRT2582633	hsa-miR-548i	CLIP-seq
MIRT2582634	hsa-miR-548j	CLIP-seq
MIRT2582635	hsa-miR-548k	CLIP-seq
MIRT2582636	hsa-miR-548l	CLIP-seq
MIRT2582637	hsa-miR-548n	CLIP-seq
MIRT2582638	hsa-miR-548w	CLIP-seq
MIRT2582639	hsa-miR-548y	CLIP-seq
MIRT2582640	hsa-miR-559	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:2000145	Process	Regulation of cell motility	TAS

MIM	HGNC	e!Ensembl
610894	29862	ENSG00000169752

Protein

UniProt ID

Q8WWG1

Protein name

Pro-neuregulin-4, membrane-bound isoform (Pro-NRG4) [Cleaved into: Neuregulin-4 (NRG-4)]

Protein function

Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	9 → 44	EGF-like domain	Domain

Sequence

MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH

Sequence length

115

Interactions

View interactions

	KEGG		Reactome
	ErbB signaling pathway Amyotrophic lateral sclerosis		Signaling by ERBB2 Signaling by ERBB4 SHC1 events in ERBB2 signaling PI3K events in ERBB4 signaling SHC1 events in ERBB4 signaling PIP3 activates AKT signaling GRB2 events in ERBB2 signaling PI3K events in ERBB2 signaling Constitutive Signaling by Aberrant PI3K in Cancer RAF/MAP kinase cascade ERBB2 Regulates Cell Motility PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling ERBB2 Activates PTK6 Signaling Downregulation of ERBB2 signaling Signaling by ERBB2 KD Mutants Signaling by ERBB2 TMD/JMD mutants

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Gout	Gout			GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining
Beta ketothiolase deficiency	Inhibit	15583696
Carcinoma Renal Cell	Associate	29633253
Coronary Disease	Associate	36915073
Diabetes Mellitus Type 2	Associate	36915073
Fatty Liver	Inhibit	39735994
Fatty Liver Alcoholic	Inhibit	39735994
Glioblastoma	Associate	34054873
Glioma	Associate	34054873
Hypertension	Associate	36915073
Insulin Resistance	Associate	31064233
Lichen Planus Oral	Associate	23492901
Lumbar Stenosis Familial	Associate	34020649
Melanoma	Associate	24709886
Neoplasms	Inhibit	24728052
Neoplasms	Associate	34054873
Non alcoholic Fatty Liver Disease	Inhibit	33989346
Polycystic Ovary Syndrome	Stimulate	31064233
Renal Insufficiency Chronic	Associate	39333727
Stomach Neoplasms	Associate	24728052
Tertiary Lymphoid Structures	Associate	38151289
Urinary Bladder Neoplasms	Associate	15583696

NRG4 (neuregulin 4)