PIWIL4 (piwi like RNA-mediated gene silencing 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
143689
Gene name Gene Name - the full gene name approved by the HGNC.
Piwi like RNA-mediated gene silencing 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PIWIL4
Synonyms (NCBI Gene) Gene synonyms aliases
HIWI2, MIWI2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q21
Summary Summary of gene provided in NCBI Entrez Gene.
PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT018636 hsa-miR-335-5p Microarray 18185580
MIRT023027 hsa-miR-124-3p Microarray 18668037
MIRT437516 hsa-miR-19b-3p Immunoprecipitaion 22382630
MIRT1237076 hsa-miR-1283 CLIP-seq
MIRT1237077 hsa-miR-382 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0004521 Function RNA endonuclease activity IBA
GO:0004521 Function RNA endonuclease activity ISS
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610315 18444 ENSG00000134627
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z3Z4
Protein name Piwi-like protein 4
Protein function Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity (By similarity). Acts via the piRNA metabolic process, which mediates the repression
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02170 PAZ 274 → 406 PAZ domain Domain
PF02171 Piwi 546 → 838 Piwi domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:17544373, PubMed:22483988, PubMed:25038252, PubMed:28025795, PubMed:28711973). Detected in retina, retinal pigment epithelia cells (RPE) (at protein level) (PubMed:28025795). {ECO:0000269|PubMed:17544373,
Sequence 
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL
Sequence length 852
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Show/Hide Text Mining Associations (32)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32087603
Amyotrophic Lateral Sclerosis Associate 35015250
Arthritis Rheumatoid Associate 27893851
Azoospermia Associate 29317647
Breast Neoplasms Associate 26957540, 27177224, 30226541
Carcinogenesis Associate 22483988
Carcinoma Embryonal Associate 32372724
Carcinoma Hepatocellular Associate 23398123, 27894076
Carcinoma Non Small Cell Lung Inhibit 25742785
Carcinoma Ovarian Epithelial Associate 24440970