PIWIL4 (piwi like RNA-mediated gene silencing 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 143689
Gene name Piwi like RNA-mediated gene silencing 4
Gene symbol PIWIL4
Synonyms (NCBI Gene)
HIWI2MIWI2
Chromosome 11
Chromosome location 11q21
Summary PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
13
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (13)
miRTarBase ID miRNA Experiments Reference
MIRT018636 hsa-miR-335-5p Microarray 18185580
MIRT023027 hsa-miR-124-3p Microarray 18668037
MIRT437516 hsa-miR-19b-3p Immunoprecipitaion 22382630
MIRT1237076 hsa-miR-1283 CLIP-seq
MIRT1237077 hsa-miR-382 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (32)
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0004521 Function RNA endonuclease activity IBA
GO:0004521 Function RNA endonuclease activity ISS
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610315 18444 ENSG00000134627
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z3Z4
Protein name Piwi-like protein 4
Protein function Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity (By similarity). Acts via the piRNA metabolic process, which mediates the repression
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02170 PAZ 274 → 406 PAZ domain Domain
PF02171 Piwi 546 → 838 Piwi domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:17544373, PubMed:22483988, PubMed:25038252, PubMed:28025795, PubMed:28711973). Detected in retina, retinal pigment epithelia cells (RPE) (at protein level) (PubMed:28025795). {ECO:0000269|PubMed:17544373,
Sequence 
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL
Sequence length 852
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Likely benign rs146415204 RCV005933025
Clear cell carcinoma of kidney Benign rs116084295 RCV005910160
Gastric cancer Likely benign rs146415204 RCV005933028
Lung cancer Benign rs116084295 RCV005910162
Show/Hide Text Mining Associations (32)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32087603
Amyotrophic Lateral Sclerosis Associate 35015250
Arthritis Rheumatoid Associate 27893851
Azoospermia Associate 29317647
Breast Neoplasms Associate 26957540, 27177224, 30226541
Carcinogenesis Associate 22483988
Carcinoma Embryonal Associate 32372724
Carcinoma Hepatocellular Associate 23398123, 27894076
Carcinoma Non Small Cell Lung Inhibit 25742785
Carcinoma Ovarian Epithelial Associate 24440970