ASB15 (ankyrin repeat and SOCS box containing 15)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
142685
Gene name Gene Name - the full gene name approved by the HGNC.
Ankyrin repeat and SOCS box containing 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ASB15
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the suppressor of cytokine signaling box superfamily. The proteins in this superfamily participate in the ubiquitin-proteasome system for the degradation of proteins in the cell cycle and signal transduction pathways. Alterna
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT802171 hsa-miR-4698 CLIP-seq
MIRT802172 hsa-miR-4742-5p CLIP-seq
MIRT802173 hsa-miR-4762-5p CLIP-seq
MIRT802174 hsa-miR-498 CLIP-seq
MIRT2444068 hsa-miR-4519 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0016567 Process Protein ubiquitination IEA
GO:0035556 Process Intracellular signal transduction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
619757 19767 ENSG00000146809
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Q8WXK1
Protein name Ankyrin repeat and SOCS box protein 15 (ASB-15)
Protein function May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 137 → 207 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 195 → 273 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 214 → 305 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 247 → 337 Ankyrin repeats (3 copies) Repeat
PF13606 Ank_3 380 → 408 Ankyrin repeat Repeat
PF07525 SOCS_box 534 → 575 SOCS box Domain
Sequence 
MDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFVPLSAQNRKLVEAIKQGHIPELQ
EYVKYKYAMDEADEKGWFPLHEAVVQPIQQILEIVLDASYKTLWEFKTCDGETPLTLAVK
AGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSA
MHEAAKQGRKDIVALLLKHGGNVHLRDGFGVTPLGVAAEYGHCDVLEHLIHKGGDVLALA
DDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKYLIPVTS
KNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLLADHISQSYDDERKTALYFGVSN
NDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRLLLSHGANVNCYFMHVNDTRFPS
VIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNP
FCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSALEVQREWPEIRQILENPCSLKHL
CRLKIRRLMGLQKLCQPASVEKLPLPPAIQRYILFKEYDLYGQELKLT
Sequence length 588
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<