Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	140
Gene name Gene Name - the full gene name approved by the HGNC.	Adenosine A3 receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADORA3
Synonyms (NCBI Gene) Gene synonyms aliases	A3AR
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates

Show/Hide all(64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT717466	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT717465	hsa-miR-15a-5p	HITS-CLIP	19536157
MIRT717464	hsa-miR-15b-5p	HITS-CLIP	19536157
MIRT717463	hsa-miR-16-5p	HITS-CLIP	19536157
MIRT717462	hsa-miR-195-5p	HITS-CLIP	19536157
MIRT717461	hsa-miR-424-5p	HITS-CLIP	19536157
MIRT717460	hsa-miR-497-5p	HITS-CLIP	19536157
MIRT717459	hsa-miR-6838-5p	HITS-CLIP	19536157
MIRT717458	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT717457	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT717456	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT717455	hsa-miR-103a-3p	HITS-CLIP	19536157
MIRT717454	hsa-miR-107	HITS-CLIP	19536157
MIRT717453	hsa-miR-324-5p	HITS-CLIP	19536157
MIRT717452	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT717451	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT717466	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT717465	hsa-miR-15a-5p	HITS-CLIP	19536157
MIRT717464	hsa-miR-15b-5p	HITS-CLIP	19536157
MIRT717463	hsa-miR-16-5p	HITS-CLIP	19536157
MIRT717462	hsa-miR-195-5p	HITS-CLIP	19536157
MIRT717461	hsa-miR-424-5p	HITS-CLIP	19536157
MIRT717460	hsa-miR-497-5p	HITS-CLIP	19536157
MIRT717459	hsa-miR-6838-5p	HITS-CLIP	19536157
MIRT717458	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT717457	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT717456	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT717455	hsa-miR-103a-3p	HITS-CLIP	19536157
MIRT717454	hsa-miR-107	HITS-CLIP	19536157
MIRT717453	hsa-miR-324-5p	HITS-CLIP	19536157
MIRT717452	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT717451	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT769626	hsa-miR-219-5p	CLIP-seq
MIRT769627	hsa-miR-3064-5p	CLIP-seq
MIRT769628	hsa-miR-3921	CLIP-seq
MIRT769629	hsa-miR-4265	CLIP-seq
MIRT769630	hsa-miR-4296	CLIP-seq
MIRT769631	hsa-miR-4322	CLIP-seq
MIRT769632	hsa-miR-4417	CLIP-seq
MIRT769633	hsa-miR-4445	CLIP-seq
MIRT769634	hsa-miR-4640-5p	CLIP-seq
MIRT769635	hsa-miR-4649-3p	CLIP-seq
MIRT769636	hsa-miR-4653-5p	CLIP-seq
MIRT769637	hsa-miR-4726-5p	CLIP-seq
MIRT769638	hsa-miR-4782-3p	CLIP-seq
MIRT769639	hsa-miR-508-3p	CLIP-seq
MIRT769640	hsa-miR-548c-3p	CLIP-seq
MIRT769641	hsa-miR-604	CLIP-seq
MIRT769642	hsa-miR-647	CLIP-seq
MIRT2167943	hsa-miR-2110	CLIP-seq
MIRT2167944	hsa-miR-3974	CLIP-seq
MIRT2167945	hsa-miR-4271	CLIP-seq
MIRT2167946	hsa-miR-4725-3p	CLIP-seq
MIRT2167947	hsa-miR-493	CLIP-seq
MIRT2167948	hsa-miR-653	CLIP-seq
MIRT2383962	hsa-miR-1224-3p	CLIP-seq
MIRT2383963	hsa-miR-1260	CLIP-seq
MIRT2383964	hsa-miR-1260b	CLIP-seq
MIRT2383965	hsa-miR-1270	CLIP-seq
MIRT2383966	hsa-miR-1280	CLIP-seq
MIRT2383967	hsa-miR-4683	CLIP-seq
MIRT2383968	hsa-miR-4708-5p	CLIP-seq
MIRT2383969	hsa-miR-532-3p	CLIP-seq
MIRT2383970	hsa-miR-620	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17216675
RELA	Unknown	17216675

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8399349
GO:0006954	Process	Inflammatory response	TAS	9164961
GO:0007165	Process	Signal transduction	TAS	8399349, 9380026
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	9380026
GO:0008016	Process	Regulation of heart contraction	TAS	9837869
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	27886186
GO:0009611	Process	Response to wounding	TAS	9837869
GO:0030336	Process	Negative regulation of cell migration	IMP	27886186
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	27886186

MIM	HGNC	e!Ensembl
600445	268	ENSG00000282608

Protein

UniProt ID

P0DMS8

Protein name

Adenosine receptor A3

Protein function

[Isoform 2]: Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase (PubMed:8234299).

PDB

8X16 , 8X17

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	29 → 282	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the lung and bone. Expressed at lower levels in osteosarcoma tissues (at protein level). {ECO:0000269|PubMed:27886186}.

Sequence

MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE

Sequence length

318

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Sphingolipid signaling pathway Neuroactive ligand-receptor interaction		Adenosine P1 receptors G alpha (i) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Myocardial infarction	Myocardial Infarction		20132822, 12160945	ClinVar

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	22146575, 31140226
Calcinosis	Associate	31875581
Carcinoma Hepatocellular	Associate	29768061
Cardiomyopathy Dilated	Associate	35618744
Chronic Periodontitis	Associate	22319752
Colitis Ulcerative	Associate	19253308
Coronary Disease	Associate	27091178
Crohn Disease	Associate	19253308
Familial Primary Pulmonary Hypertension	Associate	33478117
Heart Failure	Associate	29955603
Inflammation	Associate	19253308, 22146575, 22319752, 24864134
Inflammatory Bowel Diseases	Associate	19253308, 24864134
Ischemic Stroke	Associate	28054643
Leukemia Lymphocytic Chronic B Cell	Associate	19897574
Leukemia Promyelocytic Acute	Associate	8645277
Lung Neoplasms	Associate	36285419
Malformations of Cortical Development Group I	Associate	8645277
Mental Disorders	Associate	39706190
Myocardial Infarction	Associate	36553589
Myopathies Structural Congenital	Associate	36275756
Neoplasms	Associate	19897574, 35039871, 36285419
Neoplasms	Stimulate	28971320
Periodontitis	Associate	22319752
Pneumonia Lipid	Stimulate	26194548
Respiratory Distress Syndrome	Associate	36056346
Status Asthmaticus	Associate	21437670
Thyroid Neoplasms	Associate	18059189
Urinary Bladder Neoplasms	Associate	36275756

ADORA3 (adenosine A3 receptor)