Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1395
Gene name Gene Name - the full gene name approved by the HGNC.	Corticotropin releasing hormone receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRHR2
Synonyms (NCBI Gene) Gene synonyms aliases	CRF-RB, CRF2, CRFR2, HM-CRF
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the G-protein coupled receptor 2 family, and the subfamily of corticotropin releasing hormone receptor. This receptor shows high affinity for corticotropin releasing hormone (CRH), and also binds CRH-related pep

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs7793837	A>C,T	Drug-response	Genic upstream transcript variant, intron variant, 5 prime UTR variant

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017454	hsa-miR-335-5p	Microarray	18185580
MIRT909564	hsa-miR-1237	CLIP-seq
MIRT909565	hsa-miR-1248	CLIP-seq
MIRT909566	hsa-miR-1285	CLIP-seq
MIRT909567	hsa-miR-19a	CLIP-seq
MIRT909568	hsa-miR-19b	CLIP-seq
MIRT909569	hsa-miR-296-5p	CLIP-seq
MIRT909570	hsa-miR-3134	CLIP-seq
MIRT909571	hsa-miR-3187-5p	CLIP-seq
MIRT909572	hsa-miR-3194-3p	CLIP-seq
MIRT909573	hsa-miR-326	CLIP-seq
MIRT909574	hsa-miR-330-5p	CLIP-seq
MIRT909575	hsa-miR-378g	CLIP-seq
MIRT909576	hsa-miR-4301	CLIP-seq
MIRT909577	hsa-miR-4426	CLIP-seq
MIRT909578	hsa-miR-4486	CLIP-seq
MIRT909579	hsa-miR-4521	CLIP-seq
MIRT909580	hsa-miR-4647	CLIP-seq
MIRT909581	hsa-miR-4662b	CLIP-seq
MIRT909582	hsa-miR-4696	CLIP-seq
MIRT909583	hsa-miR-4764-5p	CLIP-seq
MIRT909584	hsa-miR-483-5p	CLIP-seq
MIRT909585	hsa-miR-612	CLIP-seq
MIRT909586	hsa-miR-767-3p	CLIP-seq
MIRT909587	hsa-miR-942	CLIP-seq
MIRT1969604	hsa-miR-103a	CLIP-seq
MIRT1969605	hsa-miR-107	CLIP-seq
MIRT1969606	hsa-miR-1301	CLIP-seq
MIRT1969607	hsa-miR-4328	CLIP-seq
MIRT1969608	hsa-miR-4684-3p	CLIP-seq
MIRT1969609	hsa-miR-5047	CLIP-seq
MIRT1969610	hsa-miR-548c-3p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11329063
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8536644
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IBA	21873635
GO:0017046	Function	Peptide hormone binding	IBA	21873635
GO:0030425	Component	Dendrite	IBA	21873635
GO:0043404	Function	Corticotropin-releasing hormone receptor activity	IBA	21873635
GO:0043679	Component	Axon terminus	IBA	21873635
GO:0060291	Process	Long-term synaptic potentiation	IBA	21873635
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IEA

MIM	HGNC	e!Ensembl
602034	2358	ENSG00000106113

Protein

UniProt ID

Q13324

Protein name

Corticotropin-releasing factor receptor 2 (CRF-R-2) (CRF-R2) (CRFR-2) (Corticotropin-releasing hormone receptor 2) (CRH-R-2) (CRH-R2)

Protein function

G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G protei

PDB

3N93 , 3N95 , 3N96 , 6PB1 , 7TRY , 7TS0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	37 → 101	Hormone receptor domain	Family
PF00002	7tm_2	113 → 355	7 transmembrane receptor (Secretin family)	Family

Sequence

MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIV
AWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV

Sequence length

411

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Cushing syndrome		Class B/2 (Secretin family receptors) G alpha (s) signalling events Synthesis, secretion, and deacylation of Ghrelin ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Hypertension	Hypertensive disease	rs13306026	10742107

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder	15192151, 12832554, 18843268, 17467808	ClinVar
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	36277017
Adrenocortical Adenoma	Associate	37062723
Asthma	Associate	18408560
Carcinoma Renal Cell	Associate	19437022
Chronic Disease	Associate	27773939
Colitis Associated Neoplasms	Associate	31882463
Colitis Ulcerative	Associate	23539366, 31882463
Colorectal Neoplasms	Associate	28929494
COVID 19	Associate	34185889
Cushing Syndrome	Associate	37062723, 37543650
Cystitis Interstitial	Inhibit	31844086
Depressive Disorder	Associate	26808377
Endometrial Neoplasms	Associate	19433256, 28109061
Inflammation	Associate	23539366
Irritable Bowel Syndrome	Associate	26808377
Kidney Neoplasms	Associate	19437022
Leukemia Lymphoma Adult T Cell	Associate	34446027
Lung Neoplasms	Associate	22665367
Lymphatic Metastasis	Associate	36277017
Myopia	Associate	34241624
Neoplasms	Associate	19437022, 28929494, 31882463
Obesity	Associate	27773939
Polycystic Ovary Syndrome	Associate	37543650
Stress Disorders Post Traumatic	Inhibit	24123648
Stress Disorders Post Traumatic	Associate	24123648
Wounds and Injuries	Associate	24123648

CRHR2 (corticotropin releasing hormone receptor 2)