CRABP1 (cellular retinoic acid binding protein 1)

Gene

• Entrez ID: 1381
• Gene name: Cellular retinoic acid binding protein 1
• Gene symbol: CRABP1
• Synonyms (NCBI Gene): CRABP, CRABP-I, CRABPI, RBP5
• Chromosome: 15
• Chromosome location: 15q25.1
• Summary: This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018173	hsa-miR-335-5p	Microarray	18185580
MIRT907921	hsa-miR-1275	CLIP-seq
MIRT907922	hsa-miR-3117-5p	CLIP-seq
MIRT907923	hsa-miR-4447	CLIP-seq
MIRT907924	hsa-miR-4472	CLIP-seq
MIRT907925	hsa-miR-4525	CLIP-seq
MIRT907926	hsa-miR-4665-5p	CLIP-seq
MIRT907927	hsa-miR-4723-5p	CLIP-seq
MIRT907928	hsa-miR-625	CLIP-seq
MIRT907923	hsa-miR-4447	CLIP-seq
MIRT907924	hsa-miR-4472	CLIP-seq
MIRT2386434	hsa-miR-4651	CLIP-seq
MIRT2386435	hsa-miR-608	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Activation	18000064
RARA	Activation	18000064
ZBTB16	Activation	18000064

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IBA
GO:0001972	Function	Retinoic acid binding	IEA
GO:0005501	Function	Retinoid binding	TAS	1309505
GO:0005504	Function	Fatty acid binding	IBA
GO:0005515	Function	Protein binding	IPI	15607035, 28514442, 32296183, 33961781, 35156780
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	1309505
GO:0008289	Function	Lipid binding	IEA
GO:0015908	Process	Fatty acid transport	IBA
GO:0016918	Function	Retinal binding	IEA
GO:0019841	Function	Retinol binding	IEA

Other IDs

• MIM: 180230
• HGNC: 2338
• e!Ensembl: ENSG00000166426

Protein

• UniProt ID: P29762
• Protein name: Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)
• Protein function: Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.
• PDB: 7A9Y, 7A9Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	5 → 137	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Sequence:

  MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
  TTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELI
  LTFGADDVVCTRIYVRE

• Sequence length: 137

Pathways

Reactome:

RA biosynthesis pathway