Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1381
Gene name Gene Name - the full gene name approved by the HGNC.	Cellular retinoic acid binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRABP1
Synonyms (NCBI Gene) Gene synonyms aliases	CRABP, CRABP-I, CRABPI, RBP5
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a specific binding protein for a vitamin A family member and is thought to play an important role in retinoic acid-mediated differentiation and proliferation processes. It is structurally similar to the cellular retinol-binding proteins,

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018173	hsa-miR-335-5p	Microarray	18185580
MIRT907921	hsa-miR-1275	CLIP-seq
MIRT907922	hsa-miR-3117-5p	CLIP-seq
MIRT907923	hsa-miR-4447	CLIP-seq
MIRT907924	hsa-miR-4472	CLIP-seq
MIRT907925	hsa-miR-4525	CLIP-seq
MIRT907926	hsa-miR-4665-5p	CLIP-seq
MIRT907927	hsa-miR-4723-5p	CLIP-seq
MIRT907928	hsa-miR-625	CLIP-seq
MIRT907923	hsa-miR-4447	CLIP-seq
MIRT907924	hsa-miR-4472	CLIP-seq
MIRT2386434	hsa-miR-4651	CLIP-seq
MIRT2386435	hsa-miR-608	CLIP-seq

Transcription factors

Show/Hide all(3)

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IEA
GO:0005501	Function	Retinoid binding	TAS	1309505
GO:0005515	Function	Protein binding	IPI	15607035, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	1309505
GO:0007275	Process	Multicellular organism development	TAS	1309505
GO:0016918	Function	Retinal binding	IEA
GO:0019841	Function	Retinol binding	IEA
GO:0034653	Process	Retinoic acid catabolic process	IEA

MIM	HGNC	e!Ensembl
180230	2338	ENSG00000166426

Protein

UniProt ID

P29762

Protein name

Cellular retinoic acid-binding protein 1 (Cellular retinoic acid-binding protein I) (CRABP-I)

Protein function

Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.

PDB

7A9Y , 7A9Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	5 → 137	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE

Sequence length

137

Interactions

View interactions

	Reactome
			RA biosynthesis pathway

Disease term	Disease name	dbSNP ID	References
Causal
Esophagus neoplasm	Squamous cell carcinoma of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	17438526
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	16254461
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	16254461

Disease term	Disease name	References	Source
Unknown
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma	16254461	ClinVar
Insomnia	Insomnia		GWAS

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	17167179, 19893615, 30578081
Arthritis Psoriatic	Inhibit	1335015
Breast Neoplasms	Inhibit	26142905
Breast Neoplasms	Associate	30154364
Carcinogenesis	Associate	17167179, 24626200
Carcinoma Basal Cell	Associate	26503156, 8618041
Carcinoma Non Small Cell Lung	Stimulate	25034531
Carcinoma Renal Cell	Associate	16254461
Carcinoma Squamous Cell	Inhibit	1335015
Cell Transformation Neoplastic	Stimulate	24626200
Colorectal Neoplasms	Associate	16407376, 17065427, 17086168, 17167179, 17474983, 17591929
Endometrial Neoplasms	Associate	35069566, 38013616
Endometriosis	Associate	38013616
Leukemia Promyelocytic Acute	Associate	1648546, 18000064
Lymphatic Metastasis	Associate	24626200, 40265473
Lymphoma Large B Cell Diffuse	Associate	18288132
Malignant mesenchymal tumor	Associate	24626200
Neoplasms	Associate	17623056, 19117505, 19643405, 19893615, 24626200, 33832420
Neoplasms	Stimulate	26142905
Neural Tube Defects	Associate	29297599
Neuroblastoma	Associate	18797883, 19087254, 26843908, 6310582
Neuroendocrine Tumors	Associate	24626200
Ovarian Neoplasms	Associate	17623056, 24294399
Prostatic Neoplasms	Associate	26124181
Retinoblastoma	Associate	27488116
Schizophrenia	Associate	34667143
Thyroid Cancer Papillary	Associate	40265473
Thyroid Neoplasms	Associate	19893615, 29321030
Triple Negative Breast Neoplasms	Associate	26142905
Turcot syndrome	Stimulate	30578081

CRABP1 (cellular retinoic acid binding protein 1)