Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1365
Gene name	Claudin 3
Gene symbol	CLDN3
Synonyms (NCBI Gene)	C7orf1CPE-R2CPETR2HRVP1RVP1
Chromosome	7
Chromosome location	7q11.23
Summary	Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.

162

Show/Hide all (162)

miRTarBase ID	miRNA	Experiments
MIRT895355	hsa-miR-1193	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895357	hsa-miR-1287	CLIP-seq
MIRT895358	hsa-miR-1293	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895368	hsa-miR-3119	CLIP-seq
MIRT895369	hsa-miR-3127-3p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895371	hsa-miR-3193	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895374	hsa-miR-3675-5p	CLIP-seq
MIRT895375	hsa-miR-371b-3p	CLIP-seq
MIRT895376	hsa-miR-4267	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895378	hsa-miR-4283	CLIP-seq
MIRT895379	hsa-miR-4287	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT895382	hsa-miR-4446-3p	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT895384	hsa-miR-4466	CLIP-seq
MIRT895385	hsa-miR-4469	CLIP-seq
MIRT895386	hsa-miR-4483	CLIP-seq
MIRT895387	hsa-miR-4488	CLIP-seq
MIRT895388	hsa-miR-4489	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT895391	hsa-miR-4685-3p	CLIP-seq
MIRT895392	hsa-miR-4685-5p	CLIP-seq
MIRT895393	hsa-miR-4694-5p	CLIP-seq
MIRT895394	hsa-miR-4697-5p	CLIP-seq
MIRT895395	hsa-miR-4708-3p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT895397	hsa-miR-4730	CLIP-seq
MIRT895398	hsa-miR-4738-5p	CLIP-seq
MIRT895399	hsa-miR-4746-5p	CLIP-seq
MIRT895400	hsa-miR-4749-3p	CLIP-seq
MIRT895401	hsa-miR-4783-5p	CLIP-seq
MIRT895402	hsa-miR-486-3p	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT895404	hsa-miR-541	CLIP-seq
MIRT895405	hsa-miR-548ad	CLIP-seq
MIRT895406	hsa-miR-548q	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT895408	hsa-miR-615-5p	CLIP-seq
MIRT895409	hsa-miR-654-5p	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT895411	hsa-miR-675	CLIP-seq
MIRT895412	hsa-miR-766	CLIP-seq
MIRT895413	hsa-miR-876-3p	CLIP-seq
MIRT895414	hsa-miR-885-3p	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895355	hsa-miR-1193	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895357	hsa-miR-1287	CLIP-seq
MIRT895358	hsa-miR-1293	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT1965487	hsa-miR-2110	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895369	hsa-miR-3127-3p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895371	hsa-miR-3193	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895374	hsa-miR-3675-5p	CLIP-seq
MIRT895375	hsa-miR-371b-3p	CLIP-seq
MIRT895376	hsa-miR-4267	CLIP-seq
MIRT1965488	hsa-miR-4271	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895378	hsa-miR-4283	CLIP-seq
MIRT895379	hsa-miR-4287	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT895382	hsa-miR-4446-3p	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT895384	hsa-miR-4466	CLIP-seq
MIRT895385	hsa-miR-4469	CLIP-seq
MIRT895386	hsa-miR-4483	CLIP-seq
MIRT895387	hsa-miR-4488	CLIP-seq
MIRT895388	hsa-miR-4489	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT1965489	hsa-miR-4667-5p	CLIP-seq
MIRT895391	hsa-miR-4685-3p	CLIP-seq
MIRT895392	hsa-miR-4685-5p	CLIP-seq
MIRT895393	hsa-miR-4694-5p	CLIP-seq
MIRT895394	hsa-miR-4697-5p	CLIP-seq
MIRT1965490	hsa-miR-4700-5p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT1965491	hsa-miR-4725-3p	CLIP-seq
MIRT1965492	hsa-miR-4731-5p	CLIP-seq
MIRT895398	hsa-miR-4738-5p	CLIP-seq
MIRT895399	hsa-miR-4746-5p	CLIP-seq
MIRT895400	hsa-miR-4749-3p	CLIP-seq
MIRT895401	hsa-miR-4783-5p	CLIP-seq
MIRT895402	hsa-miR-486-3p	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT895406	hsa-miR-548q	CLIP-seq
MIRT1965493	hsa-miR-604	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT895408	hsa-miR-615-5p	CLIP-seq
MIRT1965494	hsa-miR-647	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT895411	hsa-miR-675	CLIP-seq
MIRT895412	hsa-miR-766	CLIP-seq
MIRT895413	hsa-miR-876-3p	CLIP-seq
MIRT895414	hsa-miR-885-3p	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT2201437	hsa-miR-1343	CLIP-seq
MIRT2201438	hsa-miR-1587	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT2201439	hsa-miR-4314	CLIP-seq
MIRT2201440	hsa-miR-4417	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT2201441	hsa-miR-4492	CLIP-seq
MIRT2201442	hsa-miR-4498	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT2201443	hsa-miR-4656	CLIP-seq
MIRT1965489	hsa-miR-4667-5p	CLIP-seq
MIRT2201444	hsa-miR-4675	CLIP-seq
MIRT1965490	hsa-miR-4700-5p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT895397	hsa-miR-4730	CLIP-seq
MIRT2201445	hsa-miR-4741	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT2201446	hsa-miR-516a-3p	CLIP-seq
MIRT895404	hsa-miR-541	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT2201447	hsa-miR-637	CLIP-seq
MIRT895409	hsa-miR-654-5p	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT2201448	hsa-miR-762	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SNAI1	Repression	19874710
SP1	Activation	17986852

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEP	15174142
GO:0003382	Process	Epithelial cell morphogenesis	IEA
GO:0003382	Process	Epithelial cell morphogenesis	ISS
GO:0003406	Process	Retinal pigment epithelium development	IMP	27593915
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9334247
GO:0005198	Function	Structural molecule activity	IDA	36008380
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	25849148, 28028216, 36008380
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9334247
GO:0005911	Component	Cell-cell junction	IDA	18774778
GO:0005911	Component	Cell-cell junction	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IDA	25849148
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	27593915
GO:0010628	Process	Positive regulation of gene expression	IMP	27593915
GO:0010629	Process	Negative regulation of gene expression	IMP	27593915
GO:0014045	Process	Establishment of endothelial blood-brain barrier	IEA
GO:0014045	Process	Establishment of endothelial blood-brain barrier	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9441748
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	IEA
GO:0022604	Process	Regulation of cell morphogenesis	IMP	16103090
GO:0030036	Process	Actin cytoskeleton organization	IMP	27593915
GO:0030335	Process	Positive regulation of cell migration	IMP	16103090
GO:0030336	Process	Negative regulation of cell migration	IMP	27593915
GO:0032991	Component	Protein-containing complex	IDA	25849148
GO:0034329	Process	Cell junction assembly	IMP	27593915
GO:0034331	Process	Cell junction maintenance	IEA
GO:0034331	Process	Cell junction maintenance	ISS
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0042802	Function	Identical protein binding	IDA	28028216, 36008380
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25849148
GO:0043296	Component	Apical junction complex	IMP	27593915
GO:0045217	Process	Cell-cell junction maintenance	IDA	36008380
GO:0045471	Process	Response to ethanol	IEA
GO:0070160	Component	Tight junction	IDA	30734065
GO:0070160	Component	Tight junction	IEA
GO:0070160	Component	Tight junction	IMP	20655293
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA
GO:0070830	Process	Bicellular tight junction assembly	IMP	20655293, 25849148
GO:0090303	Process	Positive regulation of wound healing	IMP	16103090
GO:0090559	Process	Regulation of membrane permeability	IMP	20655293
GO:0098632	Function	Cell-cell adhesion mediator activity	IDA	27593915
GO:0140459	Process	Response to Gram-positive bacterium	IEA
GO:0150111	Process	Regulation of transepithelial transport	IMP	27593915
GO:2000186	Process	Negative regulation of phosphate transmembrane transport	IDA	36008380

MIM	HGNC	e!Ensembl
602910	2045	ENSG00000165215

O15551

Protein name

Claudin-3 (Clostridium perfringens enterotoxin receptor 2) (CPE-R 2) (CPE-receptor 2) (Rat ventral prostate.1 protein homolog) (hRVP1)

Protein function

Barrier-forming claudin. Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	3 → 180	PMP-22/EMP/MP20/Claudin family	Family

Sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV

Sequence length

220

Interactions

View interactions

	KEGG
	Virion - Hepatitis viruses Cell adhesion molecules Tight junction Leukocyte transendothelial migration Pathogenic Escherichia coli infection Hepatitis C

CLDN3 (claudin 3)