Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1365
Gene name Gene Name - the full gene name approved by the HGNC.	Claudin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CLDN3
Synonyms (NCBI Gene) Gene synonyms aliases	C7orf1, CPE-R2, CPETR2, HRVP1, RVP1
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.

Show/Hide all(162)

miRTarBase ID	miRNA	Experiments
MIRT895355	hsa-miR-1193	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895357	hsa-miR-1287	CLIP-seq
MIRT895358	hsa-miR-1293	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895368	hsa-miR-3119	CLIP-seq
MIRT895369	hsa-miR-3127-3p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895371	hsa-miR-3193	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895374	hsa-miR-3675-5p	CLIP-seq
MIRT895375	hsa-miR-371b-3p	CLIP-seq
MIRT895376	hsa-miR-4267	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895378	hsa-miR-4283	CLIP-seq
MIRT895379	hsa-miR-4287	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT895382	hsa-miR-4446-3p	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT895384	hsa-miR-4466	CLIP-seq
MIRT895385	hsa-miR-4469	CLIP-seq
MIRT895386	hsa-miR-4483	CLIP-seq
MIRT895387	hsa-miR-4488	CLIP-seq
MIRT895388	hsa-miR-4489	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT895391	hsa-miR-4685-3p	CLIP-seq
MIRT895392	hsa-miR-4685-5p	CLIP-seq
MIRT895393	hsa-miR-4694-5p	CLIP-seq
MIRT895394	hsa-miR-4697-5p	CLIP-seq
MIRT895395	hsa-miR-4708-3p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT895397	hsa-miR-4730	CLIP-seq
MIRT895398	hsa-miR-4738-5p	CLIP-seq
MIRT895399	hsa-miR-4746-5p	CLIP-seq
MIRT895400	hsa-miR-4749-3p	CLIP-seq
MIRT895401	hsa-miR-4783-5p	CLIP-seq
MIRT895402	hsa-miR-486-3p	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT895404	hsa-miR-541	CLIP-seq
MIRT895405	hsa-miR-548ad	CLIP-seq
MIRT895406	hsa-miR-548q	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT895408	hsa-miR-615-5p	CLIP-seq
MIRT895409	hsa-miR-654-5p	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT895411	hsa-miR-675	CLIP-seq
MIRT895412	hsa-miR-766	CLIP-seq
MIRT895413	hsa-miR-876-3p	CLIP-seq
MIRT895414	hsa-miR-885-3p	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895355	hsa-miR-1193	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895357	hsa-miR-1287	CLIP-seq
MIRT895358	hsa-miR-1293	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT1965487	hsa-miR-2110	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895369	hsa-miR-3127-3p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895371	hsa-miR-3193	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895374	hsa-miR-3675-5p	CLIP-seq
MIRT895375	hsa-miR-371b-3p	CLIP-seq
MIRT895376	hsa-miR-4267	CLIP-seq
MIRT1965488	hsa-miR-4271	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895378	hsa-miR-4283	CLIP-seq
MIRT895379	hsa-miR-4287	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT895382	hsa-miR-4446-3p	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT895384	hsa-miR-4466	CLIP-seq
MIRT895385	hsa-miR-4469	CLIP-seq
MIRT895386	hsa-miR-4483	CLIP-seq
MIRT895387	hsa-miR-4488	CLIP-seq
MIRT895388	hsa-miR-4489	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT1965489	hsa-miR-4667-5p	CLIP-seq
MIRT895391	hsa-miR-4685-3p	CLIP-seq
MIRT895392	hsa-miR-4685-5p	CLIP-seq
MIRT895393	hsa-miR-4694-5p	CLIP-seq
MIRT895394	hsa-miR-4697-5p	CLIP-seq
MIRT1965490	hsa-miR-4700-5p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT1965491	hsa-miR-4725-3p	CLIP-seq
MIRT1965492	hsa-miR-4731-5p	CLIP-seq
MIRT895398	hsa-miR-4738-5p	CLIP-seq
MIRT895399	hsa-miR-4746-5p	CLIP-seq
MIRT895400	hsa-miR-4749-3p	CLIP-seq
MIRT895401	hsa-miR-4783-5p	CLIP-seq
MIRT895402	hsa-miR-486-3p	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT895406	hsa-miR-548q	CLIP-seq
MIRT1965493	hsa-miR-604	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT895408	hsa-miR-615-5p	CLIP-seq
MIRT1965494	hsa-miR-647	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT895411	hsa-miR-675	CLIP-seq
MIRT895412	hsa-miR-766	CLIP-seq
MIRT895413	hsa-miR-876-3p	CLIP-seq
MIRT895414	hsa-miR-885-3p	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT2201437	hsa-miR-1343	CLIP-seq
MIRT2201438	hsa-miR-1587	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT2201439	hsa-miR-4314	CLIP-seq
MIRT2201440	hsa-miR-4417	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT2201441	hsa-miR-4492	CLIP-seq
MIRT2201442	hsa-miR-4498	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT2201443	hsa-miR-4656	CLIP-seq
MIRT1965489	hsa-miR-4667-5p	CLIP-seq
MIRT2201444	hsa-miR-4675	CLIP-seq
MIRT1965490	hsa-miR-4700-5p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT895397	hsa-miR-4730	CLIP-seq
MIRT2201445	hsa-miR-4741	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT2201446	hsa-miR-516a-3p	CLIP-seq
MIRT895404	hsa-miR-541	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT2201447	hsa-miR-637	CLIP-seq
MIRT895409	hsa-miR-654-5p	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT2201448	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SNAI1	Repression	19874710
SP1	Activation	17986852

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEP	15174142
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	27593915
GO:0003382	Process	Epithelial cell morphogenesis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9334247
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	25849148
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	TAS	9334247
GO:0005911	Component	Cell-cell junction	IDA	18774778
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0005923	Component	Bicellular tight junction	IDA	25849148
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	27593915
GO:0010628	Process	Positive regulation of gene expression	IMP	27593915
GO:0010629	Process	Negative regulation of gene expression	IMP	27593915
GO:0014045	Process	Establishment of endothelial blood-brain barrier	ISS
GO:0016021	Component	Integral component of membrane	TAS	9441748
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	IEA
GO:0022604	Process	Regulation of cell morphogenesis	IMP	16103090
GO:0030335	Process	Positive regulation of cell migration	IMP	16103090
GO:0030336	Process	Negative regulation of cell migration	IMP	27593915
GO:0031532	Process	Actin cytoskeleton reorganization	IMP	27593915
GO:0032991	Component	Protein-containing complex	IDA	25849148
GO:0034331	Process	Cell junction maintenance	ISS
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0042802	Function	Identical protein binding	IPI	25849148
GO:0043296	Component	Apical junction complex	IMP	27593915
GO:0045471	Process	Response to ethanol	IEA
GO:0061045	Process	Negative regulation of wound healing	IMP	27593915
GO:0070160	Component	Tight junction	IDA	30734065
GO:0070160	Component	Tight junction	IMP	20655293
GO:0070830	Process	Bicellular tight junction assembly	IBA	21873635
GO:0070830	Process	Bicellular tight junction assembly	IMP	25849148
GO:0090303	Process	Positive regulation of wound healing	IMP	16103090
GO:0090559	Process	Regulation of membrane permeability	IMP	20655293
GO:0150111	Process	Regulation of transepithelial transport	IMP	27593915
GO:1901890	Process	Positive regulation of cell junction assembly	IMP	27593915
GO:1903348	Process	Positive regulation of bicellular tight junction assembly	IMP	20655293
GO:1905050	Process	Positive regulation of metallopeptidase activity	IMP	16103090

MIM	HGNC	e!Ensembl
602910	2045	ENSG00000165215

Protein

UniProt ID

O15551

Protein name

Claudin-3 (Clostridium perfringens enterotoxin receptor 2) (CPE-R 2) (CPE-receptor 2) (Rat ventral prostate.1 protein homolog) (hRVP1)

Protein function

Barrier-forming claudin. Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	3 → 180	PMP-22/EMP/MP20/Claudin family	Family

Sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV

Sequence length

220

Interactions

View interactions

	KEGG
	Virion - Hepatitis viruses Cell adhesion molecules Tight junction Leukocyte transendothelial migration Pathogenic Escherichia coli infection Hepatitis C

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	16367923
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA

Show/Hide Text Mining Associations (73)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	17585317
Adenocarcinoma	Associate	21255442, 27363029, 27687058
Adenocarcinoma	Stimulate	28160565
Adenocarcinoma Mucinous	Stimulate	23529315
Adenocarcinoma of Lung	Associate	28160565
Autism Spectrum Disorder	Associate	27957319
Barrett Esophagus	Stimulate	27363029
Biliary Tract Neoplasms	Associate	18854598
Brain Edema	Associate	39189437
Breast Neoplasms	Associate	15750830, 21883696, 22464177, 23529315, 26919310, 29482498, 31307407, 36412442
Breast Neoplasms	Stimulate	33714203
Calcinosis Cutis	Associate	29749528
Carcinogenesis	Associate	17291259, 24333468
Carcinoma Endometrioid	Stimulate	23529315
Carcinoma Non Small Cell Lung	Inhibit	15153803
Carcinoma Non Small Cell Lung	Associate	24625834, 32965722
Carcinoma Ovarian Epithelial	Associate	17653889
Carcinoma Papillary	Associate	18313739, 19426958
Carcinoma Renal Cell	Associate	15750830, 18587324
Carcinoma Squamous Cell	Associate	17585317, 24294371, 25820701, 32518268
Carcinoma Squamous Cell	Inhibit	29511369
Cholangiocarcinoma	Associate	33441949
Colonic Neoplasms	Associate	24069372
Colorectal Neoplasms	Associate	16253248, 21209152, 24069372, 32945502
Demyelinating Diseases	Associate	34008771
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Stimulate	17291259
Endometrial Neoplasms	Associate	18313739, 18384777, 18850381
Endometriosis	Associate	18384777
Esophageal Neoplasms	Associate	33638948
Esophageal Squamous Cell Carcinoma	Associate	19137073
Fever	Inhibit	34162953
Gastrointestinal Neoplasms	Associate	18801625
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23529315, 31044387
Hypothyroidism Congenital Nongoitrous 2	Associate	18384777
Hypotrichosis	Stimulate	17291259
Hypoxia	Inhibit	34162953
Hypoxia	Associate	36674626
Idiopathic Pulmonary Fibrosis	Associate	18955738, 32001212
Inflammation	Associate	16007110, 17442054
Intestinal Diseases	Associate	29749528
Laryngeal Neoplasms	Associate	31115553
Leukoaraiosis	Inhibit	34008771
Lung Neoplasms	Associate	24625834, 29511369
Lymphatic Metastasis	Inhibit	25820701
Malignant mesenchymal tumor	Associate	26919310
Meibomian Gland Dysfunction	Associate	21372006
Mesothelioma	Associate	16505274
Mesothelioma Malignant	Associate	16505274
Mixed Tumor Malignant	Stimulate	23529315
Neoplasm Invasiveness	Associate	15153803, 17291259
Neoplasm Metastasis	Associate	19874710, 23097631, 25820701, 29511369, 36412442
Neoplasms	Associate	15750830, 15905176, 16836752, 19426958, 23097631, 25820701, 27363029, 28287265, 29511369, 29749528, 31044387, 31307407, 33761685, 34251747, 36412442
Neoplasms	Inhibit	36614243
Neoplasms Cystic Mucinous and Serous	Stimulate	23529315
Neoplasms Fibroepithelial	Associate	25687451
Ovarian Diseases	Associate	20053926
Ovarian Neoplasms	Associate	15905176, 17986852, 19426958, 20053926, 21255442, 23097631, 30081720, 37418532
Pancreatic Neoplasms	Stimulate	16836752
Poroma	Associate	31044387
Prostatic Neoplasms	Associate	21255442, 39595976
Prostatic Neoplasms Castration Resistant	Inhibit	36614243
Prostatitis	Associate	37518873
Renal Insufficiency Chronic	Associate	37833387
Rhinitis Allergic	Associate	33441633
Sarcoidosis	Associate	18955738
Skin Neoplasms	Associate	24294371
Stomach Neoplasms	Associate	16367923, 17459057, 24333468, 25755790, 28586067, 29749528, 33761685, 34251747
Thyroiditis	Stimulate	16836752
Triple Negative Breast Neoplasms	Associate	22638807, 23443971, 24390667, 29482498
Urinary Bladder Diseases	Stimulate	16836752
Urticaria Solar	Associate	24294371
Uterine Neoplasms	Associate	15785748
Vulvar Neoplasms	Associate	22170432

CLDN3 (claudin 3)