Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	134
Gene name	Adenosine A1 receptor
Gene symbol	ADORA1
Synonyms (NCBI Gene)	RDC7
Chromosome	1
Chromosome location	1q32.1
Summary	The protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments
MIRT769574	hsa-miR-1205	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT769577	hsa-miR-1909	CLIP-seq
MIRT769578	hsa-miR-1915	CLIP-seq
MIRT769579	hsa-miR-1976	CLIP-seq
MIRT769580	hsa-miR-3202	CLIP-seq
MIRT769581	hsa-miR-3918	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT769583	hsa-miR-4650-5p	CLIP-seq
MIRT769584	hsa-miR-4661-3p	CLIP-seq
MIRT769585	hsa-miR-4726-3p	CLIP-seq
MIRT769586	hsa-miR-4747-5p	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT1927025	hsa-miR-1266	CLIP-seq
MIRT769578	hsa-miR-1915	CLIP-seq
MIRT1927026	hsa-miR-24	CLIP-seq
MIRT1927027	hsa-miR-4514	CLIP-seq
MIRT1927028	hsa-miR-4518	CLIP-seq
MIRT1927029	hsa-miR-4645-5p	CLIP-seq
MIRT1927030	hsa-miR-4673	CLIP-seq
MIRT1927031	hsa-miR-4692	CLIP-seq
MIRT1927032	hsa-miR-4717-3p	CLIP-seq
MIRT769585	hsa-miR-4726-3p	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT1927033	hsa-miR-940	CLIP-seq
MIRT2167878	hsa-miR-1184	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT2167879	hsa-miR-1273f	CLIP-seq
MIRT2167880	hsa-miR-136	CLIP-seq
MIRT2167881	hsa-miR-141	CLIP-seq
MIRT2167882	hsa-miR-15a	CLIP-seq
MIRT2167883	hsa-miR-15b	CLIP-seq
MIRT2167884	hsa-miR-16	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT2167885	hsa-miR-195	CLIP-seq
MIRT2167886	hsa-miR-1972	CLIP-seq
MIRT2167887	hsa-miR-200a	CLIP-seq
MIRT2167888	hsa-miR-2117	CLIP-seq
MIRT2167889	hsa-miR-22	CLIP-seq
MIRT1927026	hsa-miR-24	CLIP-seq
MIRT2167890	hsa-miR-3176	CLIP-seq
MIRT2167891	hsa-miR-3183	CLIP-seq
MIRT2167892	hsa-miR-3665	CLIP-seq
MIRT2167893	hsa-miR-3922-3p	CLIP-seq
MIRT2167894	hsa-miR-424	CLIP-seq
MIRT2167895	hsa-miR-4255	CLIP-seq
MIRT2167896	hsa-miR-4269	CLIP-seq
MIRT2167897	hsa-miR-4273	CLIP-seq
MIRT2167898	hsa-miR-4279	CLIP-seq
MIRT2167899	hsa-miR-4283	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT2167900	hsa-miR-4435	CLIP-seq
MIRT2167901	hsa-miR-4437	CLIP-seq
MIRT2167902	hsa-miR-4447	CLIP-seq
MIRT2167903	hsa-miR-4472	CLIP-seq
MIRT2167904	hsa-miR-4488	CLIP-seq
MIRT1927027	hsa-miR-4514	CLIP-seq
MIRT769583	hsa-miR-4650-5p	CLIP-seq
MIRT1927031	hsa-miR-4692	CLIP-seq
MIRT2167905	hsa-miR-4697-5p	CLIP-seq
MIRT2167906	hsa-miR-4723-3p	CLIP-seq
MIRT2167907	hsa-miR-4736	CLIP-seq
MIRT2167908	hsa-miR-4742-5p	CLIP-seq
MIRT2167909	hsa-miR-4756-3p	CLIP-seq
MIRT2167910	hsa-miR-497	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT2167911	hsa-miR-615-5p	CLIP-seq
MIRT2167912	hsa-miR-922	CLIP-seq
MIRT1927033	hsa-miR-940	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT2167881	hsa-miR-141	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT2167887	hsa-miR-200a	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Activation	9547356
RELA	Activation	9547356

Show/Hide all (95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001609	Function	G protein-coupled adenosine receptor activity	ISS	11390975
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	ISS	11390975
GO:0001666	Process	Response to hypoxia	IEA
GO:0001883	Function	Purine nucleoside binding	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IEA
GO:0002674	Process	Negative regulation of acute inflammatory response	IEA
GO:0002686	Process	Negative regulation of leukocyte migration	IEA
GO:0002793	Process	Positive regulation of peptide secretion	IEA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0003093	Process	Regulation of glomerular filtration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16481441, 23291003, 28298427
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25644539
GO:0005886	Component	Plasma membrane	IDA	27134041
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1530647
GO:0005929	Component	Cilium	IDA
GO:0006612	Process	Protein targeting to membrane	IEA
GO:0006909	Process	Phagocytosis	TAS	8360491
GO:0006954	Process	Inflammatory response	TAS	8360491
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1530647
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	7818494
GO:0007399	Process	Nervous system development	TAS	8450977
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IEA
GO:0014074	Process	Response to purine-containing compound	IDA	25644539
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030673	Component	Axolemma	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0032244	Process	Positive regulation of nucleoside transport	IEA
GO:0032279	Component	Asymmetric synapse	IEA
GO:0032795	Function	Heterotrimeric G-protein binding	IEA
GO:0032900	Process	Negative regulation of neurotrophin production	IEA
GO:0035306	Process	Positive regulation of dephosphorylation	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	ISS	11390975
GO:0042311	Process	Vasodilation	IEA
GO:0042321	Process	Negative regulation of circadian sleep/wake cycle, sleep	IEA
GO:0042323	Process	Negative regulation of circadian sleep/wake cycle, non-REM sleep	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043268	Process	Positive regulation of potassium ion transport	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0044297	Component	Cell body	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050890	Process	Cognition	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IEA
GO:0050996	Process	Positive regulation of lipid catabolic process	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0070254	Process	Mucus secretion	IEA
GO:0070256	Process	Negative regulation of mucus secretion	IEA
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IEA
GO:0097190	Process	Apoptotic signaling pathway	TAS	7818494
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900453	Process	Negative regulation of long-term synaptic depression	IEA

MIM	HGNC	e!Ensembl
102775	262	ENSG00000163485

P30542

Protein name

Adenosine receptor A1

Protein function

Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.

PDB

5N2S , 5UEN , 6D9H , 7LD3 , 7LD4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	26 → 288	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD

Sequence length

326

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway cAMP signaling pathway Sphingolipid signaling pathway Neuroactive ligand-receptor interaction Regulation of lipolysis in adipocytes Renin secretion Morphine addiction		Adenosine P1 receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
ADORA1-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	rs200347485, rs75070458, rs61731145, rs61731146	RCV003924119 RCV003951814 RCV004758743 RCV003975715

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Stimulate	18241242
Anxiety	Associate	24943643, 33235193
Anxiety Disorders	Associate	26317759
Arthritis Psoriatic	Associate	39684939
Asthma	Associate	36818476
Asthma Aspirin Induced	Associate	19019667
Atrial Fibrillation	Associate	27462069
Attention Deficit Disorder with Hyperactivity	Associate	26317759
Brain Injuries Traumatic	Associate	20609566
Breast Neoplasms	Associate	19935720, 28971320, 32777015, 33096318
Cardiovascular Diseases	Associate	21603615
Colorectal Neoplasms	Associate	27814614
Coronary Disease	Associate	27091178
Depressive Disorder	Associate	26317759
Diffuse Neurofibrillary Tangles with Calcification	Associate	14655750
Encephalitis	Associate	31353670
Epilepsy Post Traumatic	Associate	20609566
Hot Flashes	Associate	32217888
Insulin Resistance	Associate	34944069
Keratoconus	Associate	37001853
Mammary Neoplasms Animal	Associate	32777015
Mental Disorders	Associate	24943643
Metabolic Syndrome	Associate	34944069
Myocardial Ischemia	Associate	21603615
Neoplasm Metastasis	Inhibit	24114056
Neoplasm Metastasis	Associate	32766727
Neoplasms	Associate	24896321
Neoplasms	Inhibit	28971320
Neuroectodermal Tumors Primitive	Inhibit	24114056
Neuroendocrine Tumors	Associate	23158174
Obesity	Associate	34944069
Obsessive Compulsive Disorder	Associate	26317759
Ovarian Neoplasms	Associate	37337170
Pain	Associate	38128761
Parkinson Disease	Associate	32817461
Scleroderma Systemic	Associate	39684939
Status Asthmaticus	Associate	17959644
Stomach Neoplasms	Associate	24896321
Thyroid Cancer Papillary	Associate	17914110, 32766727
Tics	Associate	26317759
Tourette Syndrome	Associate	26317759

ADORA1 (adenosine A1 receptor)