Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
133418
Gene name Gene Name - the full gene name approved by the HGNC.
Embigin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EMB
Synonyms (NCBI Gene) Gene synonyms aliases
GP70
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transmembrane glycoprotein that is a member of the immunoglobulin superfamily. The encoded protein may be involved in cell growth and development by mediating interactions between the cell and extracellular matrix. A pseudogene of this
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT026174 hsa-miR-192-5p Microarray 19074876
MIRT047611 hsa-miR-10a-5p CLASH 23622248
MIRT043608 hsa-miR-151a-3p CLASH 23622248
MIRT658710 hsa-miR-8084 HITS-CLIP 23824327
MIRT658709 hsa-miR-1250-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 33961781
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane ISS
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615669 30465 ENSG00000170571
Protein
UniProt ID Q6PCB8
Protein name Embigin
Protein function Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites witho
PDB 7YR5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 71 156 Immunoglobulin domain Domain
PF07679 I-set 159 254 Immunoglobulin I-set domain Domain
Sequence
MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEIMANNFSLESH
NISLTEHSSMPVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQLENNYLVSATG
STLYTQYRFTIINSKQMGSYSCFFREEKEQRGTFNF
KVPELHGKNKPLISYVGDSTVLTC
KCQNCFPLNWTWYSSNGSVKVPVGVQMNKYVINGTYANETKLKITQLLEEDGESYWCRAL
FQLGESEEHIELVV
LSYLVPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDEGKEFEQ
IEQLKSDDSNGIENNVPRHRKNESLGQ
Sequence length 327
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Proton-coupled monocarboxylate transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Breast cancer Invasive breast cancer, Breast cancer N/A N/A GWAS
Breast Cancer Postmenopausal breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes, Type 2 diabetes (adjusted for BMI), Type 2 diabetes (PheCode 250.2), Type 2 diabetes or schizophrenia (pleiotropy) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 26090721
Carcinoma Basal Cell Inhibit 26090721
Hereditary Breast and Ovarian Cancer Syndrome Inhibit 26090721
Leukemia Myeloid Acute Associate 36864492
Prostatitis Associate 21787388
Triple Negative Breast Neoplasms Associate 26090721