Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	133308
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 9 member B2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC9B2
Synonyms (NCBI Gene) Gene synonyms aliases	NHA2, NHE10, NHEDC2
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q24
Summary Summary of gene provided in NCBI Entrez Gene.	Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	18000046, 18508966, 36177733
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006814	Process	Sodium ion transport	IDA	18508966, 36177733
GO:0006814	Process	Sodium ion transport	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010348	Function	Lithium:proton antiporter activity	IDA	36177733
GO:0010348	Function	Lithium:proton antiporter activity	IMP	18000046, 28154142
GO:0010351	Process	Lithium ion transport	IDA	36177733
GO:0015297	Function	Antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	EXP	28154142
GO:0015385	Function	Sodium:proton antiporter activity	IDA	36177733
GO:0015385	Function	Sodium:proton antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	IMP	18000046, 28154142
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	18508966
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042802	Function	Identical protein binding	IPI	28071645
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0055037	Component	Recycling endosome	IEA
GO:0055037	Component	Recycling endosome	ISS
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055078	Process	Sodium ion homeostasis	IEA
GO:0055078	Process	Sodium ion homeostasis	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0072583	Process	Clathrin-dependent endocytosis	IEA
GO:0097228	Component	Sperm principal piece	IEA
GO:0097228	Component	Sperm principal piece	ISS
GO:0097708	Component	Intracellular vesicle	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IBA
GO:1902600	Process	Proton transmembrane transport	IEA
GO:2001206	Process	Positive regulation of osteoclast development	IEA

MIM	HGNC	e!Ensembl
611789	25143	ENSG00000164038

Protein

UniProt ID

Q86UD5

Protein name

Sodium/hydrogen exchanger 9B2 (Na(+)/H(+) exchanger NHA2) (Na(+)/H(+) exchanger-like domain-containing protein 2) (NHE domain-containing protein 2) (Sodium/hydrogen exchanger-like domain-containing protein 2) (Solute carrier family 9 subfamily B member 2)

Protein function

Electroneutral Na(+) Li(+)/H(+) antiporter that extrudes Na(+) or Li(+) in exchange for external protons across the membrane (PubMed:18000046, PubMed:18508966, PubMed:22948142, PubMed:28154142, PubMed:36177733). Uses the proton gradient/membrane

PDB

7B4L , 7B4M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00999	Na_H_Exchanger	115 → 518	Sodium/hydrogen exchanger family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:18508966). High levels detected in the distal tubules of the kidney nephron (PubMed:18508966). Detected in red blood cells (at protein level) (PubMed:18000046, PubMed:18508966). {ECO:0000269|PubMed:18000046, EC

Sequence

MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQ
ETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIII
LFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIA
LSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFV
LGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV
FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFP
GSGGLCTLVMAFLAGMGWTSEKAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGL
CVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGE
KQLEDYGMDVLTVAFLSILITAPIGSLLIGLLGPRLLQKVEHQNKDEEVQGETSVQV

Sequence length

537

Interactions

View interactions

	Reactome
			Stimuli-sensing channels

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Essential Hypertension	Associate	20053353
Hypertension	Associate	20053353
Inflammation	Stimulate	22419871

SLC9B2 (solute carrier family 9 member B2)