Gene Gene information from NCBI Gene database.
Entrez ID 132625
Gene name ZFP42 zinc finger protein
Gene symbol ZFP42
Synonyms (NCBI Gene)
REX-1REX1ZNF754zfp-42
Chromosome 4
Chromosome location 4q35.2
miRNA miRNA information provided by mirtarbase database.
124
miRTarBase ID miRNA Experiments Reference
MIRT530012 hsa-miR-1277-5p PAR-CLIP 22012620
MIRT530011 hsa-miR-5692b PAR-CLIP 22012620
MIRT530010 hsa-miR-5692c PAR-CLIP 22012620
MIRT530009 hsa-miR-323b-3p PAR-CLIP 22012620
MIRT458359 hsa-miR-4704-5p PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
POU5F1 Activation 17068183
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 14688391
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614572 30949 ENSG00000179059
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MM3
Protein name Zinc finger protein 42 homolog (Zfp-42) (Reduced expression protein 1) (REX-1) (hREX-1) (Zinc finger protein 754)
Protein function Involved in the reprogramming of X-chromosome inactivation during the acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding RNA antisense to XIST. Binds DXPas34 enhancer within the TSIX promoter. Involved in ES cel
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 217 239 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 245 269 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 275 299 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed
Sequence
MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGP
QALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSL
EYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINK
EYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHT
GEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHA
NTNKNEQEGK
Sequence length 310
Interactions View interactions