Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
132625
Gene name Gene Name - the full gene name approved by the HGNC.
ZFP42 zinc finger protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFP42
Synonyms (NCBI Gene) Gene synonyms aliases
REX-1, REX1, ZNF754, zfp-42
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q35.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT530012 hsa-miR-1277-5p PAR-CLIP 22012620
MIRT530011 hsa-miR-5692b PAR-CLIP 22012620
MIRT530010 hsa-miR-5692c PAR-CLIP 22012620
MIRT530009 hsa-miR-323b-3p PAR-CLIP 22012620
MIRT458359 hsa-miR-4704-5p PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
POU5F1 Activation 17068183
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0003700 Function DNA-binding transcription factor activity NAS 14688391
GO:0005515 Function Protein binding IPI 32296183
GO:0005667 Component Transcription regulator complex IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614572 30949 ENSG00000179059
Protein
UniProt ID Q96MM3
Protein name Zinc finger protein 42 homolog (Zfp-42) (Reduced expression protein 1) (REX-1) (hREX-1) (Zinc finger protein 754)
Protein function Involved in the reprogramming of X-chromosome inactivation during the acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding RNA antisense to XIST. Binds DXPas34 enhancer within the TSIX promoter. Involved in ES cel
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 217 239 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 245 269 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 275 299 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed
Sequence
MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGP
QALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSL
EYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINK
EYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHT
GEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHA
NTNKNEQEGK
Sequence length 310
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Beckwith Wiedemann Syndrome Associate 30221575
Birk Barel Mental Retardation Dysmorphism Syndrome Associate 30221575
Carcinoma Renal Cell Associate 22610075
Carcinoma Squamous Cell Stimulate 21446939
Colorectal Neoplasms Associate 38092774
Endometriosis Associate 19690622
Lung Neoplasms Associate 37563730
Neoplasms Stimulate 21446939
Neoplasms Associate 27729459, 32430478, 34183450, 37563730
Prostatic Neoplasms Associate 20232320, 34183450