TRIM71 (tripartite motif containing 71)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
131405
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 71
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM71
Synonyms (NCBI Gene) Gene synonyms aliases
HYC4, HYDCC1, LIN-41, LIN41
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HYC4
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an E3 ubiquitin-protein ligase that binds with miRNAs and maintains the growth and upkeep of embryonic stem cells. This gene also is involved in the G1-S phase transition of the cell cycle. [provided by RefSeq, Dec 2015
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
SNP ID Visualize variation Clinical significance Consequence
rs1045177462 G>A Likely-pathogenic Missense variant, coding sequence variant
rs1575362216 G>A Pathogenic Missense variant, coding sequence variant
rs1575362239 G>A Likely-pathogenic Missense variant, coding sequence variant
rs1575362492 G>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(253)
miRTarBase ID miRNA Experiments Reference
MIRT002077 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002077 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002076 hsa-let-7c-5p Luciferase reporter assay 17890240
MIRT002076 hsa-let-7c-5p Luciferase reporter assay 17890240
MIRT002077 hsa-let-7a-5p Luciferase reporter assay 18829576
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(28)
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle ISS
GO:0000209 Process Protein polyubiquitination IBA 21873635
GO:0000932 Component P-body IDA 23125361
GO:0000932 Component P-body ISS
GO:0001843 Process Neural tube closure IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
618570 32669 ENSG00000206557
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q2Q1W2
Protein name E3 ubiquitin-protein ligase TRIM71 (EC 2.3.2.27) (Protein lin-41 homolog) (RING-type E3 ubiquitin transferase TRIM71) (Tripartite motif-containing protein 71)
Protein function E3 ubiquitin-protein ligase that cooperates with the microRNAs (miRNAs) machinery and promotes embryonic stem cells proliferation and maintenance (Probable). Binds to miRNAs and associates with AGO2, participating in post-transcriptional repress
PDB 7QRX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00643 zf-B_box 273 → 314 B-box zinc finger Domain
PF00630 Filamin 482 → 577 Filamin/ABP280 repeat Domain
PF01436 NHL 606 → 633 NHL repeat Repeat
PF01436 NHL 653 → 680 NHL repeat Repeat
PF01436 NHL 700 → 727 NHL repeat Repeat
PF01436 NHL 747 → 774 NHL repeat Repeat
PF01436 NHL 794 → 821 NHL repeat Repeat
PF01436 NHL 841 → 868 NHL repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in testis. {ECO:0000269|PubMed:15722555}.
Sequence 
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLP
CLHAFCRPCLEAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLL
DAVVATADEPPPKNGRAGAPAGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSA
PGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIER
GPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE
CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVAEQVEMKAKVV
QSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSS
GAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEV
SDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG
DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA
CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTR
NHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQS
ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ
MDRPSGIAITPDGMIVVVDFGNNRILVF
Sequence length 868
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MicroRNAs in cancer   Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Hydrocephalus hydrocephalus, congenital communicating, 1 GenCC
Multiple Sclerosis Multiple Sclerosis GWAS
Show/Hide Text Mining Associations (9)
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 31732746
Carcinoma Hepatocellular Associate 31732746, 36244648
Hydrocephalus Associate 29983323, 32816599, 40603987
Leukemia Myeloid Acute Associate 25996682
Liposarcoma Myxoid Associate 25115389
Neoplasms Associate 25996682
Neoplasms Inhibit 31732746
Neuraminidase 1 deficiency Associate 25115389
Urinary Bladder Neoplasms Associate 33685397