Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	131
Gene name Gene Name - the full gene name approved by the HGNC.	Alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADH7
Synonyms (NCBI Gene) Gene synonyms aliases	ADH4
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxyste

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018740	hsa-miR-335-5p	Microarray	18185580
MIRT755738	hsa-miR-21-5p	qRT-PCR	35235474
MIRT768708	hsa-miR-1	CLIP-seq
MIRT768709	hsa-miR-206	CLIP-seq
MIRT768710	hsa-miR-3545-3p	CLIP-seq
MIRT768711	hsa-miR-3673	CLIP-seq
MIRT768712	hsa-miR-4698	CLIP-seq
MIRT768713	hsa-miR-607	CLIP-seq
MIRT768714	hsa-miR-613	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IDA	9600267, 16787387
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	TAS	8074657
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IBA	21873635
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IDA	7876099
GO:0004031	Function	Aldehyde oxidase activity	IDA	9600267
GO:0004745	Function	Retinol dehydrogenase activity	IBA	21873635
GO:0004745	Function	Retinol dehydrogenase activity	IDA	7876099, 9600267, 11997393, 15369820, 16787387
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006068	Process	Ethanol catabolic process	IEA
GO:0006069	Process	Ethanol oxidation	IBA	21873635
GO:0006069	Process	Ethanol oxidation	IDA	7876099, 10969996
GO:0006069	Process	Ethanol oxidation	TAS
GO:0008270	Function	Zinc ion binding	IBA	21873635
GO:0009617	Process	Response to bacterium	IDA	11410738
GO:0010430	Process	Fatty acid omega-oxidation	IDA	9600267
GO:0019841	Function	Retinol binding	IDA	9228021
GO:0035276	Function	Ethanol binding	IDA	9228021
GO:0042572	Process	Retinol metabolic process	IBA	21873635
GO:0042573	Process	Retinoic acid metabolic process	IBA	21873635
GO:0045471	Process	Response to ethanol	IDA	9600267
GO:0048019	Function	Receptor antagonist activity	IDA	9600267
GO:0050153	Function	Omega-hydroxydecanoate dehydrogenase activity	IEA
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA

MIM	HGNC	e!Ensembl
600086	256	ENSG00000196344

Protein

UniProt ID

P40394

Protein name

All-trans-retinol dehydrogenase [NAD(+)] ADH7 (EC 1.1.1.105) (Alcohol dehydrogenase class 4 mu/sigma chain) (EC 1.1.1.1) (Alcohol dehydrogenase class IV mu/sigma chain) (Gastric alcohol dehydrogenase) (Omega-hydroxydecanoate dehydrogenase ADH7) (EC 1.1.1.

Protein function

Catalyzes the NAD-dependent oxidation of all-trans-retinol, alcohol, and omega-hydroxy fatty acids and their derivatives (PubMed:15369820, PubMed:16787387, PubMed:9600267). Oxidizes preferentially all trans-retinol, all-trans-4-hydroxyretinol, 9

PDB

1AGN , 1D1S , 1D1T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08240	ADH_N	46 → 172	Alcohol dehydrogenase GroES-like domain	Domain
PF00107	ADH_zinc_N	214 → 350	Zinc-binding dehydrogenase	Family

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in stomach.

Sequence

MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
VLPFKKISEGFELLNSGQSIRTVLTF

Sequence length

386

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Fatty acid degradation Tyrosine metabolism Pyruvate metabolism Retinol metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Metabolic pathways Alcoholic liver disease		Ethanol oxidation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	18500343

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Hypertension	Hypertension	GWAS
Eating Disorders	Eating Disorders	GWAS

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Pain	Associate	37712142
Adenocarcinoma	Inhibit	29808834
Adrenocortical Carcinoma	Associate	32147670
Anemia Sickle Cell	Associate	37712142
Aniridia	Associate	34827649, 40570009
Carcinoma Non Small Cell Lung	Associate	29808834
Chronic Pain	Associate	37712142
Creutzfeldt Jakob Syndrome	Associate	24916380
Digestive System Neoplasms	Associate	21437268
Esophageal Squamous Cell Carcinoma	Associate	24722735
Head and Neck Neoplasms	Associate	25770642
Inflammation	Inhibit	40334825
Mouth Neoplasms	Associate	20336794
Neoplasms	Inhibit	18500343
Neoplasms	Associate	18500343, 26516624
Neoplasms Squamous Cell	Inhibit	29808834
Retinitis Pigmentosa	Associate	24916380
Squamous Cell Carcinoma of Head and Neck	Associate	20336794, 21940907
Stomach Neoplasms	Associate	28586067, 32799763

ADH7 (alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide)