REG3G (regenerating family member 3 gamma)

Gene

• Entrez ID: 130120
• Gene name: Regenerating family member 3 gamma
• Gene symbol: REG3G
• Synonyms (NCBI Gene): LPPM429, PAP IB, PAP-1B, PAP1B, PAPIB, REG III, REG-III, UNQ429
• Chromosome: 2
• Chromosome location: 2p12
• Summary: This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobia

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1299967	hsa-miR-142-5p	CLIP-seq
MIRT1299968	hsa-miR-3143	CLIP-seq
MIRT1299969	hsa-miR-340	CLIP-seq
MIRT1299970	hsa-miR-543	CLIP-seq
MIRT1299971	hsa-miR-548a-5p	CLIP-seq
MIRT1299972	hsa-miR-548ab	CLIP-seq
MIRT1299973	hsa-miR-548ak	CLIP-seq
MIRT1299974	hsa-miR-548b-5p	CLIP-seq
MIRT1299975	hsa-miR-548c-5p	CLIP-seq
MIRT1299976	hsa-miR-548d-5p	CLIP-seq
MIRT1299977	hsa-miR-548h	CLIP-seq
MIRT1299978	hsa-miR-548i	CLIP-seq
MIRT1299979	hsa-miR-548j	CLIP-seq
MIRT1299980	hsa-miR-548k	CLIP-seq
MIRT1299981	hsa-miR-548l	CLIP-seq
MIRT1299982	hsa-miR-548w	CLIP-seq
MIRT1299983	hsa-miR-548y	CLIP-seq
MIRT1299984	hsa-miR-559	CLIP-seq
MIRT1299985	hsa-miR-802	CLIP-seq
MIRT2089198	hsa-miR-3617	CLIP-seq
MIRT2089199	hsa-miR-641	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0006953	Process	Acute-phase response	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0010838	Process	Positive regulation of keratinocyte proliferation	ISS
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0042834	Function	Peptidoglycan binding	IBA	21873635
GO:0042834	Function	Peptidoglycan binding	IDA	16931762
GO:0043434	Process	Response to peptide hormone	IBA	21873635
GO:0044278	Process	Cell wall disruption in other organism	IBA	21873635
GO:0044278	Process	Cell wall disruption in other organism	IDA	16931762
GO:0045617	Process	Negative regulation of keratinocyte differentiation	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051838	Process	Cytolysis by host of symbiont cells	IDA	16931762
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	21873635
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	16931762
GO:0070492	Function	Oligosaccharide binding	IBA	21873635
GO:0070492	Function	Oligosaccharide binding	IDA	16931762
GO:0090303	Process	Positive regulation of wound healing	ISS

Other IDs

• MIM: 609933
• HGNC: 29595
• e!Ensembl: ENSG00000143954

Protein

• UniProt ID: Q6UW15
• Protein name: Regenerating islet-derived protein 3-gamma (REG-3-gamma) (Pancreatitis-associated protein 1B) (PAP-1B) (Pancreatitis-associated protein IB) (PAP IB) (Regenerating islet-derived protein III-gamma) (REG III) (Reg III-gamma) [Cleaved into: Regenerating islet
• Protein function: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	57 → 173	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in pancreas, where it may be restricted to exocrine pancreas. Moderate expression levels in testis and weak in heart, kidney and placenta. {ECO:0000269|PubMed:15556304, ECO:0000269|PubMed:15777617}.
• Sequence:

  MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKS
  WMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGW
  EWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

• Sequence length: 175

Pathways

Reactome:

Antimicrobial peptides

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Hypertension	Hypertensive disease	rs13306026	27798352

Unknown
Disease term	Disease name	Evidence	References	Source
Alzheimer disease	Alzheimer disease			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinogenesis	Stimulate	34930787
Colitis Ulcerative	Associate	32842596
Colorectal Neoplasms	Associate	35395711
Sarcoidosis	Associate	33923774