Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
127700
Gene name Gene Name - the full gene name approved by the HGNC.
Organic solute carrier partner 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OSCP1
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf102, NOR1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT035529 hsa-miR-638 Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23554459
MIRT035529 hsa-miR-638 Luciferase reporter assay, Microarray, qRT-PCR, Western blot 23554459
MIRT646709 hsa-miR-33a-5p HITS-CLIP 23824327
MIRT646708 hsa-miR-33b-5p HITS-CLIP 23824327
MIRT646707 hsa-miR-6875-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 19727524
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608854 29971 ENSG00000116885
Protein
UniProt ID Q8WVF1
Protein name Protein OSCP1 (hOSCP1) (Organic solute transport protein 1) (Oxidored-nitro domain-containing protein 1)
Protein function May be involved in drug clearance in the placenta.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10188 Oscp1 17 199 Organic solute transport protein 1 Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in testis, also found in placenta and to a lesser extent in thymus and small intestine; abundantly expressed in tumor-derived cell lines (PubMed:16006562). Ubiquitously expressed (PubMed:12819961). {ECO:0000269|
Sequence
MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRK
FMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKD
VLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLH
IRVSMFLKDKVQNNNGRFV
LPVSGPVPWGTEVPGLIRMFNNKGEEVKRIEFKHGGNYVPA
PKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLA
RLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELA
RIMGEFEITEQPRLSTSKGDDLLAMMDEL
Sequence length 389
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetic Retinopathy Diabetic retinopathy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 29135101, 36918874
Glioblastoma Associate 37962027
Neoplasms Inhibit 37962027