Gene Gene information from NCBI Gene database.
Entrez ID 1271
Gene name Ciliary neurotrophic factor receptor
Gene symbol CNTFR
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9p13.3
Summary This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and ge
miRNA miRNA information provided by mirtarbase database.
87
miRTarBase ID miRNA Experiments Reference
MIRT029854 hsa-miR-26b-5p Microarray 19088304
MIRT438715 hsa-miR-708-5p Luciferase reporter assayqRT-PCRWestern blot 23970374
MIRT438715 hsa-miR-708-5p Luciferase reporter assayqRT-PCRWestern blot 23970374
MIRT901530 hsa-miR-2467-3p CLIP-seq
MIRT901531 hsa-miR-3154 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0001967 Process Suckling behavior IEA
GO:0003360 Process Brainstem development IEA
GO:0004896 Function Cytokine receptor activity IEA
GO:0004897 Function Ciliary neurotrophic factor receptor activity IBA
GO:0004897 Function Ciliary neurotrophic factor receptor activity IDA 12643274
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
118946 2170 ENSG00000122756
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26992
Protein name Ciliary neurotrophic factor receptor subunit alpha (CNTF receptor subunit alpha) (CNTFR-alpha)
Protein function Binds to CNTF. The alpha subunit provides the receptor specificity. Receptor for heterodimeric neurotropic cytokine composed of CLCF1/CLC and CRLF1/CLF-1 (PubMed:26858303). Acts as a receptor for the neuroprotective peptide humanin as part of a
PDB 1UC6 , 8D74 , 8D7E , 8D7H , 8D7R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 205 294 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Nervous system and skeletal muscle.
Sequence
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWS
VAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI
Sequence length 372
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
  IL-6-type cytokine receptor ligand interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OSTEOARTHRITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCOLIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma of Lung Associate 34745015
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 32190687
★☆☆☆☆
Found in Text Mining only
Crisponi syndrome Associate 17436251
★☆☆☆☆
Found in Text Mining only
Hypothyroidism Inhibit 33600668
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Associate 31538427
★☆☆☆☆
Found in Text Mining only
Lymphoma Large Cell Anaplastic Associate 17077326
★☆☆☆☆
Found in Text Mining only
Neoplasm Metastasis Associate 35280443
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 34745015
★☆☆☆☆
Found in Text Mining only
Stuve Wiedemann syndrome Associate 17436252
★☆☆☆☆
Found in Text Mining only
Thyroid cancer medullary Associate 35280443
★☆☆☆☆
Found in Text Mining only