Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1271
Gene name Gene Name - the full gene name approved by the HGNC.
Ciliary neurotrophic factor receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNTFR
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and ge
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029854 hsa-miR-26b-5p Microarray 19088304
MIRT438715 hsa-miR-708-5p Luciferase reporter assay, qRT-PCR, Western blot 23970374
MIRT438715 hsa-miR-708-5p Luciferase reporter assay, qRT-PCR, Western blot 23970374
MIRT901530 hsa-miR-2467-3p CLIP-seq
MIRT901531 hsa-miR-3154 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001967 Process Suckling behavior IEA
GO:0003360 Process Brainstem development IEA
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0004897 Function Ciliary neurotrophic factor receptor activity IBA 21873635
GO:0004897 Function Ciliary neurotrophic factor receptor activity IDA 12643274
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
118946 2170 ENSG00000122756
Protein
UniProt ID P26992
Protein name Ciliary neurotrophic factor receptor subunit alpha (CNTF receptor subunit alpha) (CNTFR-alpha)
Protein function Binds to CNTF. The alpha subunit provides the receptor specificity. Receptor for heterodimeric neurotropic cytokine composed of CLCF1/CLC and CRLF1/CLF-1 (PubMed:26858303). Acts as a receptor for the neuroprotective peptide humanin as part of a
PDB 1UC6 , 8D74 , 8D7E , 8D7H , 8D7R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 205 294 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Nervous system and skeletal muscle.
Sequence
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWS
VAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI
Sequence length 372
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
  IL-6-type cytokine receptor ligand interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 19503088
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34745015
Breast Neoplasms Associate 32190687
Crisponi syndrome Associate 17436251
Hypothyroidism Inhibit 33600668
Leukemia Myeloid Acute Associate 31538427
Lymphoma Large Cell Anaplastic Associate 17077326
Neoplasm Metastasis Associate 35280443
Neoplasms Associate 34745015
Stuve Wiedemann syndrome Associate 17436252
Thyroid cancer medullary Associate 35280443