Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124540
Gene name Gene Name - the full gene name approved by the HGNC.
Musashi RNA binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MSI2
Synonyms (NCBI Gene) Gene synonyms aliases
MSI2H
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001533 hsa-miR-155-5p pSILAC 18668040
MIRT001533 hsa-miR-155-5p Western blot 20584899
MIRT042254 hsa-miR-484 CLASH 23622248
MIRT039469 hsa-miR-652-3p CLASH 23622248
MIRT493077 hsa-miR-5580-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0003727 Function Single-stranded RNA binding IEA
GO:0003729 Function MRNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607897 18585 ENSG00000153944
Protein
UniProt ID Q96DH6
Protein name RNA-binding protein Musashi homolog 2 (Musashi-2)
Protein function RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system (By similarity).
PDB 6C8U , 6DBP , 6NTY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 23 92 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 112 181 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous; detected at low levels. {ECO:0000269|PubMed:12649177}.
Sequence
MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKR
SRGFGFVTFADPASVDKVLGQPHHELDSKTID
PKVAFPRRAQPKMVTRTKKIFVGGLSAN
TVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMV
E
CKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQ
FPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
AASPQPGSGFGHGIAGPLIATAFTNGYH
Sequence length 328
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  mRNA surveillance pathway  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Ovarian cancer Epithelial ovarian cancer N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34145929
Adenoma Associate 34237057
Breast Neoplasms Associate 27941885, 35589867
Carcinoma Hepatocellular Stimulate 24305552
Colorectal Neoplasms Associate 26775684, 30604502, 32828126, 34237057, 40302097
Diabetes Mellitus Associate 28542303
Diabetes Mellitus Type 2 Associate 28542303
Dyslexia Associate 23190410
Endometriosis Associate 35269992
Glioblastoma Associate 34047477