Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124460
Gene name Gene Name - the full gene name approved by the HGNC.
Sorting nexin 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNX20
Synonyms (NCBI Gene) Gene synonyms aliases
SLIC1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
SNX20 interacts with the cytoplasmic domain of PSGL1 (SELPLG; MIM 600738) and cycles PSGL1 into endosomes.[supplied by OMIM, Feb 2010]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT718849 hsa-miR-4639-3p HITS-CLIP 19536157
MIRT718848 hsa-miR-1207-3p HITS-CLIP 19536157
MIRT718847 hsa-miR-6777-3p HITS-CLIP 19536157
MIRT718846 hsa-miR-4254 HITS-CLIP 19536157
MIRT718845 hsa-miR-6787-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 18196517, 25416956, 31515488, 32296183, 32814053
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding ISS
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613281 30390 ENSG00000167208
Protein
UniProt ID Q7Z614
Protein name Sorting nexin-20 (Selectin ligand-interactor cytoplasmic 1) (SLIC-1)
Protein function May play a role in cellular vesicle trafficking. Has been proposed to function as a sorting protein that targets SELPLG into endosomes, but has no effect on SELPLG internalization from the cell surface, or on SELPLG-mediated cell-cell adhesion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00787 PX 103 187 PX domain Domain
Sequence
MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTREL
QQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDF
AKLQKALLKTFREEIEDVEFPRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREF
LDFLTRP
ELREAFGCLRAGQYPRALELLLRVLPLQEKLTAHCPAAAVPALCAVLLCHRDL
DRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYALGKDFVTLQERLEESQLRRPT
PRGITLKELTVREYLH
Sequence length 316
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease, Crohn's disease or Leprosy (opposite effect) N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease, Inflammatory bowel disease (MTAG) N/A N/A GWAS
Leprosy Leprosy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Glioma Associate 35771139
Inflammation Associate 35771139
Neoplasms Associate 34743576
Uveal melanoma Associate 34743576