Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1236
Gene name	C-C motif chemokine receptor 7
Gene symbol	CCR7
Synonyms (NCBI Gene)	BLR2CC-CKR-7CCR-7CD197CDw197CMKBR7EBI1
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expres

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006813	hsa-let-7a-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	22251626
MIRT018216	hsa-miR-335-5p	Microarray	18185580
MIRT440980	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT440980	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT732313	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCR	27814720
MIRT732313	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCR	27814720
MIRT732697	hsa-let-7e-5p	Luciferase reporter assayqRT-PCR	33630421
MIRT732697	hsa-let-7e-5p	Luciferase reporter assayqRT-PCR	33630421
MIRT440980	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blotting	31813289
MIRT873274	hsa-miR-1207-3p	CLIP-seq
MIRT873275	hsa-miR-1271	CLIP-seq
MIRT873276	hsa-miR-129-5p	CLIP-seq
MIRT873277	hsa-miR-146b-3p	CLIP-seq
MIRT873278	hsa-miR-182	CLIP-seq
MIRT873279	hsa-miR-1827	CLIP-seq
MIRT873280	hsa-miR-3176	CLIP-seq
MIRT873281	hsa-miR-3185	CLIP-seq
MIRT873282	hsa-miR-3186-3p	CLIP-seq
MIRT873283	hsa-miR-339-5p	CLIP-seq
MIRT873284	hsa-miR-3612	CLIP-seq
MIRT873285	hsa-miR-361-5p	CLIP-seq
MIRT873286	hsa-miR-3922-3p	CLIP-seq
MIRT873287	hsa-miR-432	CLIP-seq
MIRT873288	hsa-miR-4421	CLIP-seq
MIRT873289	hsa-miR-4443	CLIP-seq
MIRT873290	hsa-miR-4690-3p	CLIP-seq
MIRT873291	hsa-miR-511	CLIP-seq
MIRT873292	hsa-miR-650	CLIP-seq
MIRT873293	hsa-miR-658	CLIP-seq
MIRT873294	hsa-miR-765	CLIP-seq
MIRT873295	hsa-miR-96	CLIP-seq
MIRT873281	hsa-miR-3185	CLIP-seq
MIRT873287	hsa-miR-432	CLIP-seq
MIRT873289	hsa-miR-4443	CLIP-seq
MIRT2196043	hsa-miR-548ad	CLIP-seq
MIRT873294	hsa-miR-765	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
EPAS1	Activation	19305150
HIF1A	Activation	17178876;19305150
KLF2	Unknown	20146713
NFKB1	Activation	11830455;19164127
NFKB1	Unknown	22158872
RELA	Activation	11830455;19164127
RELA	Unknown	22158872
TRERF1	Unknown	17006331

Show/Hide all (97)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IC	12729902
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IC	15569314
GO:0002407	Process	Dendritic cell chemotaxis	IC	15778365
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IDA	11602640, 14592837
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	IEA
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0002885	Process	Positive regulation of hypersensitivity	IEA
GO:0002885	Process	Positive regulation of hypersensitivity	ISS
GO:0002922	Process	Positive regulation of humoral immune response	IEA
GO:0002922	Process	Positive regulation of humoral immune response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	16621978
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005886	Component	Plasma membrane	IDA	21051556
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	16621978
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9153236
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	18308860
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0016493	Function	C-C chemokine receptor activity	ISS
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0030838	Process	Positive regulation of actin filament polymerization	IC	11242036
GO:0031274	Process	Positive regulation of pseudopodium assembly	IC	11242036
GO:0031529	Process	Ruffle organization	IC	15569314
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032649	Process	Regulation of type II interferon production	IEA
GO:0032649	Process	Regulation of type II interferon production	ISS
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	ISS
GO:0035757	Function	Chemokine (C-C motif) ligand 19 binding	IBA
GO:0035757	Function	Chemokine (C-C motif) ligand 19 binding	IPI	9507024
GO:0035758	Function	Chemokine (C-C motif) ligand 21 binding	IBA
GO:0035758	Function	Chemokine (C-C motif) ligand 21 binding	IPI	9507024
GO:0038117	Function	C-C motif chemokine 19 receptor activity	IBA
GO:0038117	Function	C-C motif chemokine 19 receptor activity	IDA	9507024
GO:0038119	Process	CCL19-activated CCR7 signaling pathway	IDA	14592837
GO:0038119	Process	CCL19-activated CCR7 signaling pathway	IEA
GO:0038120	Process	CCL21-activated CCR7 signaling pathway	IDA	14592837
GO:0038121	Function	C-C motif chemokine 21 receptor activity	IDA	9507024
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IC	15059845
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IC	15569314
GO:0046330	Process	Positive regulation of JNK cascade	IC	15778365
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IEA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	14592837
GO:0051491	Process	Positive regulation of filopodium assembly	IC	15569314
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IC	15059845, 15778365
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	14592837
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IC	12729902, 15778365
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	11602640
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	14592837
GO:0071731	Process	Response to nitric oxide	IC	16249377
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	TAS	18379575
GO:0097029	Process	Mature conventional dendritic cell differentiation	IEA
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	14592837
GO:2000147	Process	Positive regulation of cell motility	IC	15778365
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IEA
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	ISS
GO:2000522	Process	Positive regulation of immunological synapse formation	IEA
GO:2000522	Process	Positive regulation of immunological synapse formation	ISS
GO:2000525	Process	Positive regulation of T cell costimulation	IEA
GO:2000525	Process	Positive regulation of T cell costimulation	ISS
GO:2000526	Process	Positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	IEA
GO:2000526	Process	Positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	ISS
GO:2000547	Process	Regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IC	15059845

MIM	HGNC	e!Ensembl
600242	1608	ENSG00000126353

P32248

Protein name

C-C chemokine receptor type 7 (C-C CKR-7) (CC-CKR-7) (CCR-7) (BLR2) (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor) (CD antigen CD197)

Protein function

Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.

PDB

6QZH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	75 → 326	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Sequence

MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
IRRSSMSVEAETTTTFSP

Sequence length

378

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway		Chemokine receptors bind chemokines G alpha (i) signalling events

CCR7 (C-C motif chemokine receptor 7)