CMA1 (chymase 1)

Gene

• Entrez ID: 1215
• Gene name: Chymase 1
• Gene symbol: CMA1
• Synonyms (NCBI Gene): CYH, MCT1, chymase
• Chromosome: 14
• Chromosome location: 14q12
• Summary: This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the gene

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002003	Process	Angiotensin maturation	TAS
GO:0004175	Function	Endopeptidase activity	EXP	9256427, 12062105
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	1919436
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	8144971
GO:0004252	Function	Serine-type endopeptidase activity	TAS	1894611
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0006518	Process	Peptide metabolic process	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	EXP	2266130, 11502696
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	2071582
GO:0016485	Process	Protein processing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IDA	27068509
GO:0030141	Component	Secretory granule	IDA	29529050
GO:0030141	Component	Secretory granule	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0034769	Process	Basement membrane disassembly	IDA	27068509
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042277	Function	Peptide binding	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0050727	Process	Regulation of inflammatory response	IDA	1919436
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0140447	Process	Cytokine precursor processing	IDA	1919436

Other IDs

• MIM: 118938
• HGNC: 2097
• e!Ensembl: ENSG00000092009

Protein

• UniProt ID: P23946
• Protein name: Chymase (EC 3.4.21.39) (Alpha-chymase) (Mast cell protease I)
• Protein function: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
• PDB: 1KLT, 1NN6, 1PJP, 1T31, 2HVX, 3N7O, 3S0N, 4AFQ, 4AFS, 4AFU, 4AFZ, 4AG1, 4AG2, 4K2Y, 4K5Z, 4K60, 4K69, 4KP0, 5YJM, 5YJP, 7H60, 7H61, 7H62, 7H63, 7H64, 7H65, 7H66, 7H67, 7H68, 7H69, 7H6A, 7H6B, 7H6C, 7H6D, 7H6E, 7H6F, 7H6I, 9GBH, 9GC1, 9GC9, 9GCC, 9GCD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	22 → 240	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions. {ECO:0000269|PubMed:8144971}.
• Sequence:

  MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
  VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
  SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
  FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
  NQILQAN

• Sequence length: 247

Pathways

KEGG:

Renin-angiotensin system
Diabetic cardiomyopathy

Reactome:

Signaling by SCF-KIT
Activation of Matrix Metalloproteinases
Metabolism of Angiotensinogen to Angiotensins

<